Recombinant Human RTKN2 protein, His-tagged

Cat.No. : RTKN2-2461H
Product Overview : Recombinant Human RTKN2 protein(1-163 aa), fused with His tag, was expressed in E.coli.
Availability July 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-163 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTSELQKLEEQIANQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDICFENVTIL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name RTKN2 rhotekin 2 [ Homo sapiens ]
Official Symbol RTKN2
Synonyms RTKN2; rhotekin 2; pleckstrin homology domain containing, family K member 1 , PLEKHK1; rhotekin-2; bA531F24.1; Em:AC024597.2; FLJ39352; PH domain-containing family K member 1; pleckstrin homology domain-containing family K member 1; pleckstrin homology domain containing, family K member 1; PLEKHK1; DKFZp686J10120;
Gene ID 219790
mRNA Refseq NM_145307
Protein Refseq NP_660350
UniProt ID Q8IZC4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RTKN2 Products

Required fields are marked with *

My Review for All RTKN2 Products

Required fields are marked with *

0
cart-icon