Recombinant Human RTKN2 protein, His-tagged
| Cat.No. : | RTKN2-2461H |
| Product Overview : | Recombinant Human RTKN2 protein(1-163 aa), fused with His tag, was expressed in E.coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-163 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTSELQKLEEQIANQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDICFENVTIL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RTKN2 rhotekin 2 [ Homo sapiens ] |
| Official Symbol | RTKN2 |
| Synonyms | RTKN2; rhotekin 2; pleckstrin homology domain containing, family K member 1 , PLEKHK1; rhotekin-2; bA531F24.1; Em:AC024597.2; FLJ39352; PH domain-containing family K member 1; pleckstrin homology domain-containing family K member 1; pleckstrin homology domain containing, family K member 1; PLEKHK1; DKFZp686J10120; |
| Gene ID | 219790 |
| mRNA Refseq | NM_145307 |
| Protein Refseq | NP_660350 |
| UniProt ID | Q8IZC4 |
| ◆ Recombinant Proteins | ||
| RTKN2-2461H | Recombinant Human RTKN2 protein, His-tagged | +Inquiry |
| RTKN2-4412C | Recombinant Chicken RTKN2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RTKN2-1377HCL | Recombinant Human RTKN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RTKN2 Products
Required fields are marked with *
My Review for All RTKN2 Products
Required fields are marked with *
