Recombinant Human RTN1
Cat.No. : | RTN1-31317TH |
Product Overview : | Recombinant full length Human Reticulon 1 Isoform 3 with an N-terminal proprietary tag; predicted MWt 48.99 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 208 amino acids |
Description : | This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. This gene is considered to be a specific marker for neurological diseases and cancer, and is a potential molecular target for therapy. Alternative splicing results in multiple transcript variants. |
Molecular Weight : | 48.990kDa inclusive of tags |
Tissue specificity : | Expressed in neural and neuroendocrine tissues and cell cultures derived therefrom. Expression of isoform RTN1-C is strongly correlated with neuronal differentiation. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSF LLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAV QKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLK ELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMA VVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI PGAKRHAE |
Sequence Similarities : | Contains 1 reticulon domain. |
Gene Name | RTN1 reticulon 1 [ Homo sapiens ] |
Official Symbol | RTN1 |
Synonyms | RTN1; reticulon 1; neuroendocrine specific protein , NSP; reticulon-1; |
Gene ID | 6252 |
mRNA Refseq | NM_021136 |
Protein Refseq | NP_066959 |
MIM | 600865 |
Uniprot ID | Q16799 |
Chromosome Location | 14q21-q22 |
Function | signal transducer activity; |
◆ Recombinant Proteins | ||
RTN1-5193R | Recombinant Rat RTN1 Protein | +Inquiry |
Rtn1-8152M | Recombinant Mouse Rtn1 protein, His & GST-tagged | +Inquiry |
RTN1-2462H | Recombinant Human RTN1, GST-tagged | +Inquiry |
RTN1-4852R | Recombinant Rat RTN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RTN1-1109C | Recombinant Chicken RTN1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RTN1 Products
Required fields are marked with *
My Review for All RTN1 Products
Required fields are marked with *
0
Inquiry Basket