Recombinant Human RTP1 protein, GST-tagged
Cat.No. : | RTP1-7855H |
Product Overview : | Recombinant Human RTP1 protein(3-227 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 3-227 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | RPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPNLKHNVLSPGWKQYLELHASGRFHCSWCWHTWQSPYVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARLDESSMLEENIEGLVDNLITSLREQCYGERGGQYRIHVASRQDNRRHRGEFCEACQEGIVHWKPSEKLLEEEATTYTFSRAPSPTKSQDQ |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | RTP1 receptor (chemosensory) transporter protein 1 [ Homo sapiens ] |
Official Symbol | RTP1 |
Synonyms | RTP1; receptor (chemosensory) transporter protein 1; receptor transporter protein 1; receptor-transporting protein 1; MGC35450; receptor transporting protein 1; |
mRNA Refseq | NM_153708 |
Protein Refseq | NP_714919 |
MIM | 609137 |
UniProt ID | P59025 |
Gene ID | 132112 |
◆ Recombinant Proteins | ||
RTP1-636C | Recombinant Cynomolgus Monkey RTP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RTP1-7854H | Recombinant Human RTP1 protein, His-tagged | +Inquiry |
RTP1-7855H | Recombinant Human RTP1 protein, GST-tagged | +Inquiry |
RFL3931HF | Recombinant Full Length Human Receptor-Transporting Protein 1(Rtp1) Protein, His-Tagged | +Inquiry |
RTP1-2465H | Recombinant Human RTP1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RTP1-2118HCL | Recombinant Human RTP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RTP1 Products
Required fields are marked with *
My Review for All RTP1 Products
Required fields are marked with *
0
Inquiry Basket