Recombinant Human RXRG
| Cat.No. : | RXRG-31123TH |
| Product Overview : | Recombinant full length Human Retinoid X Receptor gamma with N terminal proprietary tag; Predicted MWt 77.00 kDa incusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 463 amino acids |
| Description : | This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternatively spliced transcript variants have been described. |
| Molecular Weight : | 77.000kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMD SHPSYTDTPVSAPRTLSAVGTPLNALGSPYRVITSAMGPP SGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCK GFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCL VMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTL VEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVS VQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYAT LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFF KLIGDTPIDTFLMEMLETPLQIT |
| Sequence Similarities : | Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain. |
| Gene Name | RXRG retinoid X receptor, gamma [ Homo sapiens ] |
| Official Symbol | RXRG |
| Synonyms | RXRG; retinoid X receptor, gamma; retinoic acid receptor RXR-gamma; NR2B3; |
| Gene ID | 6258 |
| mRNA Refseq | NM_006917 |
| Protein Refseq | NP_008848 |
| MIM | 180247 |
| Uniprot ID | P48443 |
| Chromosome Location | 1q22-q23 |
| Pathway | Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Adipogenesis, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; |
| Function | metal ion binding; receptor activity; retinoid-X receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| RXRG-451HF | Recombinant Full Length Human RXRG Protein | +Inquiry |
| RXRG-4061R | Recombinant Rhesus monkey RXRG Protein, His-tagged | +Inquiry |
| RXRG-1932H | Recombinant Human RXRG Protein, His (Fc)-Avi-tagged | +Inquiry |
| RXRG-120H | Recombinant Human RXRG, GST-tagged | +Inquiry |
| RXRG-3882H | Recombinant Human RXRG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RXRG-2097HCL | Recombinant Human RXRG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RXRG Products
Required fields are marked with *
My Review for All RXRG Products
Required fields are marked with *
