Recombinant Human S100A13 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : S100A13-5377H
Product Overview : S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019384) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Molecular Mass : 11.5 kDa
AA Sequence : MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name S100A13 S100 calcium binding protein A13 [ Homo sapiens (human) ]
Official Symbol S100A13
Synonyms S100A13; S100 calcium binding protein A13; protein S100-A13; S100 calcium-binding protein A13;
Gene ID 6284
mRNA Refseq NM_001024213
Protein Refseq NP_001019384
MIM 601989
UniProt ID Q99584

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100A13 Products

Required fields are marked with *

My Review for All S100A13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon