Recombinant Human S100A14 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : S100A14-3018H
Product Overview : S100A14 MS Standard C13 and N15-labeled recombinant protein (NP_065723) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the S100 protein family which contains an EF-hand motif and binds calcium. The gene is located in a cluster of S100 genes on chromosome 1. Levels of the encoded protein have been found to be lower in cancerous tissue and associated with metastasis suggesting a tumor suppressor function (PMID: 19956863, 19351828).
Molecular Mass : 11.7 kDa
AA Sequence : MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name S100A14 S100 calcium binding protein A14 [ Homo sapiens (human) ]
Official Symbol S100A14
Synonyms S100A14; S100 calcium binding protein A14; protein S100-A14; BCMP84; S100A15; S114; S100 calcium-binding protein A14; breast cancer membrane protein 84;
Gene ID 57402
mRNA Refseq NM_020672
Protein Refseq NP_065723
MIM 607986
UniProt ID Q9HCY8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100A14 Products

Required fields are marked with *

My Review for All S100A14 Products

Required fields are marked with *

0
cart-icon