Recombinant Human S100A14 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100A14-3018H |
Product Overview : | S100A14 MS Standard C13 and N15-labeled recombinant protein (NP_065723) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the S100 protein family which contains an EF-hand motif and binds calcium. The gene is located in a cluster of S100 genes on chromosome 1. Levels of the encoded protein have been found to be lower in cancerous tissue and associated with metastasis suggesting a tumor suppressor function (PMID: 19956863, 19351828). |
Molecular Mass : | 11.7 kDa |
AA Sequence : | MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100A14 S100 calcium binding protein A14 [ Homo sapiens (human) ] |
Official Symbol | S100A14 |
Synonyms | S100A14; S100 calcium binding protein A14; protein S100-A14; BCMP84; S100A15; S114; S100 calcium-binding protein A14; breast cancer membrane protein 84; |
Gene ID | 57402 |
mRNA Refseq | NM_020672 |
Protein Refseq | NP_065723 |
MIM | 607986 |
UniProt ID | Q9HCY8 |
◆ Recombinant Proteins | ||
S100A14-2089HFL | Recombinant Full Length Human S100A14 Protein, C-Flag-tagged | +Inquiry |
S100a14-5667M | Recombinant Mouse S100a14 Protein, Myc/DDK-tagged | +Inquiry |
S100A14-3964H | Recombinant Human S100A14, His tagged | +Inquiry |
S100A14-1564H | Recombinant Human S100 Calcium Binding Protein A14, T7-tagged | +Inquiry |
S100A14-5821H | Recombinant Human S100A14 protein, His-sumostar-tagged | +Inquiry |
◆ Native Proteins | ||
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A14-2092HCL | Recombinant Human S100A14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A14 Products
Required fields are marked with *
My Review for All S100A14 Products
Required fields are marked with *
0
Inquiry Basket