Recombinant Human S100A14 Protein (1-104 aa), His-tagged
Cat.No. : | S100A14-2452H |
Product Overview : | Recombinant Human S100A14 Protein (1-104 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-104 aa |
Description : | Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 13.7 kDa |
AA Sequence : | MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | S100A14 S100 calcium binding protein A14 [ Homo sapiens ] |
Official Symbol | S100A14 |
Synonyms | S100A14; protein S100-A14; BCMP84; S100A15; S114; S100 calcium-binding protein A14; |
Gene ID | 57402 |
mRNA Refseq | NM_020672 |
Protein Refseq | NP_065723 |
MIM | 607986 |
UniProt ID | Q9HCY8 |
◆ Recombinant Proteins | ||
S100A14-3018H | Recombinant Human S100A14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100A14-1937H | Recombinant Human S100A14 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100A14-3723H | Recombinant Human S100A14 protein, His-tagged | +Inquiry |
S100A14-3401H | Recombinant Human S100A14, His-tagged | +Inquiry |
S100A14-7903H | Recombinant Human S100A14 protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A14-2092HCL | Recombinant Human S100A14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A14 Products
Required fields are marked with *
My Review for All S100A14 Products
Required fields are marked with *
0
Inquiry Basket