Recombinant Human S100A14 Protein (1-104 aa), His-tagged

• Cat.No.: S100A14-2452H
• Product Overview: Recombinant Human S100A14 Protein (1-104 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-104 aa
• Description: Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 13.7 kDa
• AA Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: S100A14 S100 calcium binding protein A14 [ Homo sapiens ]
• Official Symbol: S100A14
• Synonyms: S100A14; protein S100-A14; BCMP84; S100A15; S114; S100 calcium-binding protein A14
• Gene ID: 57402
• mRNA Refseq: NM_020672
• Protein Refseq: NP_065723
• MIM: 607986
• UniProt ID: Q9HCY8