Recombinant Human S100A7A protein, His-SUMO-tagged
| Cat.No. : | S100A7A-4590H |
| Product Overview : | Recombinant Human S100A7A protein(Q86SG5)(2-101aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-101aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.2 kDa |
| AA Sequence : | SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | S100A7A S100 calcium binding protein A7A [ Homo sapiens ] |
| Official Symbol | S100A7A |
| Synonyms | S100A7A; S100 calcium binding protein A7A; S100 calcium binding protein A7 like 1 , S100 calcium binding protein A15 , S100A7L1, S100A15; protein S100-A7A; S100A7f; S100 calcium binding protein A15; S100 calcium-binding protein A15; S100 calcium-binding protein A7A; S100 calcium binding protein A7-like 1; S100 calcium-binding protein A7-like 1; NICE-2; S100A15; S100A7L1; |
| Gene ID | 338324 |
| mRNA Refseq | NM_176823 |
| Protein Refseq | NP_789793 |
| UniProt ID | Q86SG5 |
| ◆ Recombinant Proteins | ||
| S100A7A-4760H | Recombinant Human S100A7A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| S100A7A-4567H | Recombinant Human S100 Calcium Binding Protein A7A, His-tagged | +Inquiry |
| S100A7A-4590H | Recombinant Human S100A7A protein, His-SUMO-tagged | +Inquiry |
| S100a7a-6852M | Recombinant Mouse S100 Calcium Binding Protein A7A, His-tagged | +Inquiry |
| S100A7A-5852H | Recombinant Human S100A7A Protein (Ser2-Gln101), N-GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A7A Products
Required fields are marked with *
My Review for All S100A7A Products
Required fields are marked with *
