Recombinant Human S100A7A protein, His-SUMO-tagged
Cat.No. : | S100A7A-4590H |
Product Overview : | Recombinant Human S100A7A protein(Q86SG5)(2-101aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-101aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.2 kDa |
AA Sequence : | SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | S100A7A S100 calcium binding protein A7A [ Homo sapiens ] |
Official Symbol | S100A7A |
Synonyms | S100A7A; S100 calcium binding protein A7A; S100 calcium binding protein A7 like 1 , S100 calcium binding protein A15 , S100A7L1, S100A15; protein S100-A7A; S100A7f; S100 calcium binding protein A15; S100 calcium-binding protein A15; S100 calcium-binding protein A7A; S100 calcium binding protein A7-like 1; S100 calcium-binding protein A7-like 1; NICE-2; S100A15; S100A7L1; |
Gene ID | 338324 |
mRNA Refseq | NM_176823 |
Protein Refseq | NP_789793 |
UniProt ID | Q86SG5 |
◆ Recombinant Proteins | ||
S100a7a-7015M | Recombinant Mouse S100a7a protein, His&MBP-tagged | +Inquiry |
S100A7A-7867M | Recombinant Mouse S100A7A Protein, His (Fc)-Avi-tagged | +Inquiry |
S100a7a-6852M | Recombinant Mouse S100 Calcium Binding Protein A7A, His-tagged | +Inquiry |
S100A7A-229H | Recombinant Human S100A7A Protein, MYC/DDK-tagged | +Inquiry |
S100A7A-4590H | Recombinant Human S100A7A protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A7A Products
Required fields are marked with *
My Review for All S100A7A Products
Required fields are marked with *
0
Inquiry Basket