Recombinant Human S100A7A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : S100A7A-4760H
Product Overview : S100A7A MS Standard C13 and N15-labeled recombinant protein (NP_789793) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.
Molecular Mass : 11.1 kDa
AA Sequence : MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name S100A7A S100 calcium binding protein A7A [ Homo sapiens (human) ]
Official Symbol S100A7A
Synonyms S100A7A; S100 calcium binding protein A7A; S100 calcium binding protein A7 like 1, S100 calcium binding protein A15, S100A7L1, S100A15; protein S100-A7A; S100A7f; S100 calcium binding protein A15; S100 calcium-binding protein A15; S100 calcium-binding protein A7A; S100 calcium binding protein A7-like 1; S100 calcium-binding protein A7-like 1; NICE-2; S100A15; S100A7L1;
Gene ID 338324
mRNA Refseq NM_176823
Protein Refseq NP_789793
MIM 617427
UniProt ID Q86SG5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100A7A Products

Required fields are marked with *

My Review for All S100A7A Products

Required fields are marked with *

0
cart-icon
0
compare icon