Recombinant Human S100A7A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100A7A-4760H
• Product Overview: S100A7A MS Standard C13 and N15-labeled recombinant protein (NP_789793) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.
• Molecular Mass: 11.1 kDa
• AA Sequence: MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100A7A S100 calcium binding protein A7A [ Homo sapiens (human) ]
• Official Symbol: S100A7A
• Synonyms: S100A7A; S100 calcium binding protein A7A; S100 calcium binding protein A7 like 1, S100 calcium binding protein A15, S100A7L1, S100A15; protein S100-A7A; S100A7f; S100 calcium binding protein A15; S100 calcium-binding protein A15; S100 calcium-binding protein A7A; S100 calcium binding protein A7-like 1; S100 calcium-binding protein A7-like 1; NICE-2; S100A15; S100A7L1
• Gene ID: 338324
• mRNA Refseq: NM_176823
• Protein Refseq: NP_789793
• MIM: 617427
• UniProt ID: Q86SG5