Recombinant Human S100A7A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100A7A-4760H |
Product Overview : | S100A7A MS Standard C13 and N15-labeled recombinant protein (NP_789793) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. |
Molecular Mass : | 11.1 kDa |
AA Sequence : | MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100A7A S100 calcium binding protein A7A [ Homo sapiens (human) ] |
Official Symbol | S100A7A |
Synonyms | S100A7A; S100 calcium binding protein A7A; S100 calcium binding protein A7 like 1, S100 calcium binding protein A15, S100A7L1, S100A15; protein S100-A7A; S100A7f; S100 calcium binding protein A15; S100 calcium-binding protein A15; S100 calcium-binding protein A7A; S100 calcium binding protein A7-like 1; S100 calcium-binding protein A7-like 1; NICE-2; S100A15; S100A7L1; |
Gene ID | 338324 |
mRNA Refseq | NM_176823 |
Protein Refseq | NP_789793 |
MIM | 617427 |
UniProt ID | Q86SG5 |
◆ Recombinant Proteins | ||
S100A7A-1686H | Recombinant Human S100A7A Protein (2-101 aa), His-tagged | +Inquiry |
S100A7A-4760H | Recombinant Human S100A7A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100A7A-4567H | Recombinant Human S100 Calcium Binding Protein A7A, His-tagged | +Inquiry |
S100A7A-5852H | Recombinant Human S100A7A Protein (Ser2-Gln101), N-GST tagged | +Inquiry |
S100a7a-145M | Recombinant Mouse S100a7a Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A7A Products
Required fields are marked with *
My Review for All S100A7A Products
Required fields are marked with *
0
Inquiry Basket