Recombinant Full Length Human S100A8 Protein, His-tagged

Cat.No. : S100A8-3732H
Product Overview : S100A8;S100 calcium binding protein A8;MRP8;Calgranulin A;CAGA;CFAG;P8;His-tagged;Human
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 1-93 aa
Description : S100A8 (S100 calcium binding protein A8), also known as MRP8 or Calgranulin A, is a calcium- and zinc-binding EF-hand protein predominantly expressed in myeloid cells including neutrophils and monocytes. It forms a heterodimer complex with S100A9 (Calprotectin) and plays critical roles in inflammatory responses, antimicrobial defense, cytoskeleton rearrangement, and arachidonic acid metabolism regulation.
Form : Liquid
Molecular Mass : 12 kDa (calculated)
AASequence : MKHHHHHHASMLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Endotoxin : <1.0 EU/ug (by LAL)
Purity : >90% (by SDS-PAGE)
Storage : Store under sterile conditions at -20°C to -80°C, aliquot, avoid repeated freeze-thaw cycles
Concentration : 1 mg/ml (by BCA)
Storage Buffer : Sterile PBS, pH7.4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100A8 Products

Required fields are marked with *

My Review for All S100A8 Products

Required fields are marked with *

0
cart-icon
0
compare icon