Recombinant Human S1PR2 protein, His-tagged
| Cat.No. : | S1PR2-6843H |
| Product Overview : | Recombinant Human S1PR2 protein(283-353 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 283-353 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | LNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | S1PR2 sphingosine-1-phosphate receptor 2 [ Homo sapiens ] |
| Official Symbol | S1PR2 |
| Synonyms | EDG5; H218; LPB2; S1P2; AGR16; EDG-5; Gpcr13 |
| Gene ID | 9294 |
| mRNA Refseq | NM_004230.3 |
| Protein Refseq | NP_004221.3 |
| MIM | 605111 |
| UniProt ID | O95136 |
| ◆ Recombinant Proteins | ||
| S1PR2-21H | Recombinant Human S1PR2 protein, MYC/DDK-tagged | +Inquiry |
| S1PR2-5220R | Recombinant Rat S1PR2 Protein | +Inquiry |
| S1pr2-1044M | Recombinant Mouse S1pr2 Protein, MYC/DDK-tagged | +Inquiry |
| RFL14786DF | Recombinant Full Length Danio Rerio Sphingosine 1-Phosphate Receptor 2(S1Pr2) Protein, His-Tagged | +Inquiry |
| S1PR2-4879R | Recombinant Rat S1PR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S1PR2 Products
Required fields are marked with *
My Review for All S1PR2 Products
Required fields are marked with *
