| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
104 |
| Description : |
Serum amyloid A protein which belongs to the SAA family is encoded by the SAA gene in humans. It is expressed by the liver and secreted in plasma. Serum amyloid A is the major acute phase reactant and apolipoprotein of the HDL complex. Elevated serum SAA protein levels may be associated with lung cancer. The level of Apo-SAA, normally 1-5 μg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL Apo-lipoprotein. Recombinant human Apo-SAA1 is an 11.7 kDa protein containing 104 amino acid residues. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 9.0, 150 mM NaCl. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by its ability to down-regulate lipid biosynthesis in aortic smooth muscle cells. The effective concentration was found to be 4 μM. |
| Molecular Mass : |
Approximately 11.7 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids. |
| AA Sequence : |
RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISNARENIQRFFGRGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Purity : |
>98% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |