Recombinant Human Saposin D Protein

• Cat.No.: Saposin D-24H
• Product Overview: Recombinant human saposin D is produced in E. coli and purified by proprietary chromatography techniques.

Specification

• Species: Human
• Source: E.coli
• Description: Saposin D is a sphingolipid activator protein required for the lysosomal breakdown of ceramide to a fatty acid and sphingosine by acid ceramidase. Human saposin D is derived from a precursor, prosaposin, by proteolytic cleavage.
• AASequence: DGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS
• Purity: > 90% by Coomassie staining
• Storage: Storage is recommended at -20 centigrade for longer periods of time
• Shipping: Product requires shipping on ice packs.
• Storage Buffer: 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, and 50% Glycerol

Gene Information

• Official Symbol: Saposin D
• Synonyms: Saposin D