Recombinant Human Saposin D Protein
| Cat.No. : | Saposin D-24H |
| Product Overview : | Recombinant human saposin D is produced in E. coli and purified by proprietary chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | Saposin D is a sphingolipid activator protein required for the lysosomal breakdown of ceramide to a fatty acid and sphingosine by acid ceramidase. Human saposin D is derived from a precursor, prosaposin, by proteolytic cleavage. |
| AASequence : | DGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS |
| Purity : | > 90% by Coomassie staining |
| Storage : | Storage is recommended at -20 centigrade for longer periods of time |
| Shipping : | Product requires shipping on ice packs. |
| Storage Buffer : | 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, and 50% Glycerol |
| Official Symbol | Saposin D |
| Synonyms | Saposin D |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Saposin D Products
Required fields are marked with *
My Review for All Saposin D Products
Required fields are marked with *



