Recombinant Human SARM1 protein, GST-tagged
| Cat.No. : | SARM1-3719H |
| Product Overview : | Recombinant Human SARM1 protein(352-573 aa), fused to GST tag, was expressed in E. coli. |
| Availability | November 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 352-573 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | EAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSG |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SARM1 sterile alpha and TIR motif containing 1 [ Homo sapiens ] |
| Official Symbol | SARM1 |
| Synonyms | SARM1; sterile alpha and TIR motif containing 1; sterile alpha and TIR motif-containing protein 1; KIAA0524; SAMD2; SARM; tir-1 homolog; SAM domain-containing protein 2; sterile alpha and Armadillo repeat protein; sterile alpha motif domain-containing protein 2; sterile alpha and HEAT/Armadillo motif protein, ortholog of Drosophila; FLJ36296; |
| Gene ID | 23098 |
| mRNA Refseq | NM_015077 |
| Protein Refseq | NP_055892 |
| MIM | 607732 |
| UniProt ID | Q6SZW1 |
| ◆ Recombinant Proteins | ||
| SARM1-5632H | Recombinant Human SARM1 protein, His-tagged | +Inquiry |
| SARM1-5766H | Recombinant Human SARM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SARM1-14675M | Recombinant Mouse SARM1 Protein | +Inquiry |
| SARM1-273H | Recombinant Human SARM1 Protein, MYC/DDK-tagged | +Inquiry |
| Sarm1-674M | Recombinant Mouse Sarm1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SARM1 Products
Required fields are marked with *
My Review for All SARM1 Products
Required fields are marked with *
