Recombinant Mouse Sarm1 protein, His-tagged
Cat.No. : | Sarm1-674M |
Product Overview : | Recombinant Mouse Sarm1 protein(Q6PDS3)(409-705aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 409-705a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | VASWKEAEVQTWLQQIGFSQYCENFREQQVDGDLLLRLTDEELQTDLGMKSSITRKRFFRELTELKTFASYATCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIRLGVHRTRILSAAREMLHSPLPCTGGKLSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVIAARNFVLVLSAGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQALPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRPSQ |
Gene Name | Sarm1 sterile alpha and HEAT/Armadillo motif containing 1 [ Mus musculus ] |
Official Symbol | Sarm1 |
Synonyms | SARM1; sterile alpha and HEAT/Armadillo motif containing 1; Sarm; MyD88-5; |
Gene ID | 93754 |
◆ Recombinant Proteins | ||
SARM1-6434H | Recombinant Human SARM1 protein(409-702aa), His-KSI-tagged | +Inquiry |
SARM1-3893R | Recombinant Rhesus Macaque SARM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SARM1-1954H | Recombinant Human SARM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SARM1-4076R | Recombinant Rhesus monkey SARM1 Protein, His-tagged | +Inquiry |
SARM1-41HFL | Recombinant Full Length Human SARM1 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sarm1 Products
Required fields are marked with *
My Review for All Sarm1 Products
Required fields are marked with *
0
Inquiry Basket