Recombinant Human SARM1 protein, His-tagged
Cat.No. : | SARM1-5632H |
Product Overview : | Recombinant Human SARM1 protein(Q6SZW1)(559-702aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 559-702aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGR |
Gene Name | SARM1 sterile alpha and TIR motif containing 1 [ Homo sapiens ] |
Official Symbol | SARM1 |
Synonyms | SARM1; sterile alpha and TIR motif containing 1; sterile alpha and TIR motif-containing protein 1; KIAA0524; SAMD2; SARM; tir-1 homolog; SAM domain-containing protein 2; sterile alpha and Armadillo repeat protein; sterile alpha motif domain-containing protein 2; sterile alpha and HEAT/Armadillo motif protein, ortholog of Drosophila; FLJ36296; |
Gene ID | 23098 |
mRNA Refseq | NM_015077 |
Protein Refseq | NP_055892 |
MIM | 607732 |
UniProt ID | Q6SZW1 |
◆ Recombinant Proteins | ||
SARM1-5766H | Recombinant Human SARM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SARM1-3199H | Recombinant Human SARM1 protein, His-tagged | +Inquiry |
SARM1-4076R | Recombinant Rhesus monkey SARM1 Protein, His-tagged | +Inquiry |
SARM1-3719H | Recombinant Human SARM1 protein, GST-tagged | +Inquiry |
SARM1-14675M | Recombinant Mouse SARM1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SARM1 Products
Required fields are marked with *
My Review for All SARM1 Products
Required fields are marked with *