Recombinant Human SARM1 protein, His-tagged

Cat.No. : SARM1-5632H
Product Overview : Recombinant Human SARM1 protein(Q6SZW1)(559-702aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 559-702aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 18.8 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGR
Gene Name SARM1 sterile alpha and TIR motif containing 1 [ Homo sapiens ]
Official Symbol SARM1
Synonyms SARM1; sterile alpha and TIR motif containing 1; sterile alpha and TIR motif-containing protein 1; KIAA0524; SAMD2; SARM; tir-1 homolog; SAM domain-containing protein 2; sterile alpha and Armadillo repeat protein; sterile alpha motif domain-containing protein 2; sterile alpha and HEAT/Armadillo motif protein, ortholog of Drosophila; FLJ36296;
Gene ID 23098
mRNA Refseq NM_015077
Protein Refseq NP_055892
MIM 607732
UniProt ID Q6SZW1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SARM1 Products

Required fields are marked with *

My Review for All SARM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon