Recombinant Human SASH1 protein, His-tagged
Cat.No. : | SASH1-7854H |
Product Overview : | Recombinant Human SASH1 protein(76-191 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 76-191 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MDVCERMEELRKRRVSQDLEVEKPDASPTSLQLRSQIEESLGFCSAVSTPEVERKNPLHKSNSEDSSVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SASH1 SAM and SH3 domain containing 1 [ Homo sapiens ] |
Official Symbol | SASH1 |
Synonyms | SASH1; SAM and SH3 domain containing 1; SAM and SH3 domain-containing protein 1; dJ323M4.1; KIAA0790; SH3D6A; 2500002E12Rik; proline-glutamate repeat-containing protein; dJ323M4; RP3-323M4.1; |
Gene ID | 23328 |
mRNA Refseq | NM_015278 |
Protein Refseq | NP_056093 |
MIM | 607955 |
UniProt ID | O94885 |
◆ Recombinant Proteins | ||
SASH1-3634H | Recombinant Human SASH1 protein, GST-tagged | +Inquiry |
SASH1-7854H | Recombinant Human SASH1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SASH1 Products
Required fields are marked with *
My Review for All SASH1 Products
Required fields are marked with *
0
Inquiry Basket