Recombinant Human SAT1 protein, GST-tagged
Cat.No. : | SAT1-3471H |
Product Overview : | Recombinant Human SAT1 protein(P21673)(5-171aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 5-171aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.5 kDa |
AA Sequence : | VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SAT1 spermidine/spermine N1-acetyltransferase 1 [ Homo sapiens ] |
Official Symbol | SAT1 |
Synonyms | SAT1; spermidine/spermine N1-acetyltransferase 1; SAT, spermidine/spermine N1 acetyltransferase; diamine acetyltransferase 1; diamine N acetyltransferase 1; SSAT; putrescine acetyltransferase; diamine N-acetyltransferase 1; polyamine N-acetyltransferase 1; spermidine/spermine N(1)-acetyltransferase 1; spermidine/spermine N1-acetyltransferase alpha; SAT; DC21; KFSD; KFSDX; SSAT-1; |
Gene ID | 6303 |
mRNA Refseq | NM_002970 |
Protein Refseq | NP_002961 |
MIM | 313020 |
UniProt ID | P21673 |
◆ Recombinant Proteins | ||
SAT1-450H | Recombinant Human SAT1 | +Inquiry |
Sat1-2044M | Recombinant Mouse Sat1 Protein, His-tagged | +Inquiry |
SAT1-4123H | Recombinant Human SAT1 protein, His-tagged | +Inquiry |
SAT1-3896R | Recombinant Rhesus Macaque SAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAT1-3471H | Recombinant Human SAT1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAT1-2056HCL | Recombinant Human SAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAT1 Products
Required fields are marked with *
My Review for All SAT1 Products
Required fields are marked with *
0
Inquiry Basket