Recombinant Human SAT1 protein, GST-tagged
| Cat.No. : | SAT1-3471H | 
| Product Overview : | Recombinant Human SAT1 protein(P21673)(5-171aa), fused to N-terminal GST tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 5-171aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 46.5 kDa | 
| AA Sequence : | VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | SAT1 spermidine/spermine N1-acetyltransferase 1 [ Homo sapiens ] | 
| Official Symbol | SAT1 | 
| Synonyms | SAT1; spermidine/spermine N1-acetyltransferase 1; SAT, spermidine/spermine N1 acetyltransferase; diamine acetyltransferase 1; diamine N acetyltransferase 1; SSAT; putrescine acetyltransferase; diamine N-acetyltransferase 1; polyamine N-acetyltransferase 1; spermidine/spermine N(1)-acetyltransferase 1; spermidine/spermine N1-acetyltransferase alpha; SAT; DC21; KFSD; KFSDX; SSAT-1; | 
| Gene ID | 6303 | 
| mRNA Refseq | NM_002970 | 
| Protein Refseq | NP_002961 | 
| MIM | 313020 | 
| UniProt ID | P21673 | 
| ◆ Recombinant Proteins | ||
| SAT1-4123H | Recombinant Human SAT1 protein, His-tagged | +Inquiry | 
| SAT1-3472H | Recombinant Human SAT1 protein, His-tagged | +Inquiry | 
| Sat1-573R | Recombinant Rat Sat1 Protein, His-tagged | +Inquiry | 
| SAT1-3471H | Recombinant Human SAT1 protein, GST-tagged | +Inquiry | 
| SAT1-2515H | Recombinant Human SAT1, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SAT1-2056HCL | Recombinant Human SAT1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAT1 Products
Required fields are marked with *
My Review for All SAT1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            