Recombinant Human SATB1 Protein, His-tagged
Cat.No. : | SATB1-2518H |
Product Overview : | Recombinant Human SATB1 protein(NP_001124482.1)(1-112 aa) was expressed in E.coli with a N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-112 aa |
Description : | This gene encodes a matrix protein which binds nuclear matrix and scaffold-associating DNAs through a unique nuclear architecture. The protein recruits chromatin-remodeling factors in order to regulate chromatin structure and gene expression. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Bio-activity : | Not Tested |
AA Sequence : | MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHSGHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIE |
Endotoxin : | Please contact the lab for more information. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Applications : | Blocking peptide |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | SATB1 SATB homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | SATB1 |
Synonyms | SATB1 |
Gene ID | 6304 |
mRNA Refseq | NM_001131010.4 |
Protein Refseq | NP_001124482.1 |
MIM | 602075 |
UniProt ID | Q01826 |
◆ Recombinant Proteins | ||
SATB1-4437C | Recombinant Chicken SATB1 | +Inquiry |
SATB1-4991H | Recombinant Human SATB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SATB1-7909M | Recombinant Mouse SATB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SATB1-2519H | Recombinant Human SATB1 Protein, His-tagged | +Inquiry |
SATB1-14686M | Recombinant Mouse SATB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SATB1-2054HCL | Recombinant Human SATB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SATB1 Products
Required fields are marked with *
My Review for All SATB1 Products
Required fields are marked with *
0
Inquiry Basket