Recombinant Human SATB1 Protein, His-tagged

Cat.No. : SATB1-2518H
Product Overview : Recombinant Human SATB1 protein(NP_001124482.1)(1-112 aa) was expressed in E.coli with a N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-112 aa
Description : This gene encodes a matrix protein which binds nuclear matrix and scaffold-associating DNAs through a unique nuclear architecture. The protein recruits chromatin-remodeling factors in order to regulate chromatin structure and gene expression.
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Bio-activity : Not Tested
AA Sequence : MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHSGHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIE
Endotoxin : Please contact the lab for more information.
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Applications : Blocking peptide
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name SATB1 SATB homeobox 1 [ Homo sapiens (human) ]
Official Symbol SATB1
Synonyms SATB1
Gene ID 6304
mRNA Refseq NM_001131010.4
Protein Refseq NP_001124482.1
MIM 602075
UniProt ID Q01826

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SATB1 Products

Required fields are marked with *

My Review for All SATB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon