Recombinant Human SATB1 Protein, His-tagged

• Cat.No.: SATB1-2518H
• Product Overview: Recombinant Human SATB1 protein(NP_001124482.1)(1-112 aa) was expressed in E.coli with a N-terminal His tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-112 aa
• Description: This gene encodes a matrix protein which binds nuclear matrix and scaffold-associating DNAs through a unique nuclear architecture. The protein recruits chromatin-remodeling factors in order to regulate chromatin structure and gene expression.
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Bio-activity: Not Tested
• AA Sequence: MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHSGHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIE
• Endotoxin: Please contact the lab for more information.
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Applications: Blocking peptide
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Information

• Gene Name: SATB1 SATB homeobox 1 [ Homo sapiens (human) ]
• Official Symbol: SATB1
• Synonyms: SATB1
• Gene ID: 6304
• mRNA Refseq: NM_001131010.4
• Protein Refseq: NP_001124482.1
• MIM: 602075
• UniProt ID: Q01826