Recombinant Human SBDS protein, His-tagged
Cat.No. : | SBDS-0420H |
Product Overview : | Recombinant Human SBDS protein(1-250 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-250 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SBDS Shwachman-Bodian-Diamond syndrome [ Homo sapiens ] |
Official Symbol | SBDS |
Synonyms | SBDS; Shwachman-Bodian-Diamond syndrome; ribosome maturation protein SBDS; CGI 97; FLJ10917; SDS; SWDS; CGI-97; |
Gene ID | 51119 |
mRNA Refseq | NM_016038 |
Protein Refseq | NP_057122 |
MIM | 607444 |
UniProt ID | Q9Y3A5 |
◆ Recombinant Proteins | ||
SBDS-2844H | Recombinant Human Shwachman-Bodian-Diamond Syndrome, His-tagged | +Inquiry |
SBDS-7911M | Recombinant Mouse SBDS Protein, His (Fc)-Avi-tagged | +Inquiry |
SBDS-11343Z | Recombinant Zebrafish SBDS | +Inquiry |
SBDS-1360C | Recombinant Chicken SBDS | +Inquiry |
SBDS-0420H | Recombinant Human SBDS protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SBDS-2052HCL | Recombinant Human SBDS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SBDS Products
Required fields are marked with *
My Review for All SBDS Products
Required fields are marked with *
0
Inquiry Basket