Recombinant Human SCD5 protein, GST-tagged
| Cat.No. : | SCD5-301239H |
| Product Overview : | Recombinant Human SCD5 (1-52 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Leu52 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SCD5 stearoyl-CoA desaturase 5 [ Homo sapiens ] |
| Official Symbol | SCD5 |
| Synonyms | SCD2; SCD4; ACOD4; FADS4; HSCD5 |
| Gene ID | 79966 |
| mRNA Refseq | NM_024906.2 |
| Protein Refseq | NP_079182.2 |
| MIM | 608370 |
| UniProt ID | Q86SK9 |
| ◆ Recombinant Proteins | ||
| RFL24208BF | Recombinant Full Length Bovine Stearoyl-Coa Desaturase 5(Scd5) Protein, His-Tagged | +Inquiry |
| SCD5-4088R | Recombinant Rhesus monkey SCD5 Protein, His-tagged | +Inquiry |
| SCD5-3905R | Recombinant Rhesus Macaque SCD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCD5-301239H | Recombinant Human SCD5 protein, GST-tagged | +Inquiry |
| RFL12605HF | Recombinant Full Length Human Stearoyl-Coa Desaturase 5(Scd5) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCD5-2043HCL | Recombinant Human SCD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCD5 Products
Required fields are marked with *
My Review for All SCD5 Products
Required fields are marked with *
