Recombinant Human SCG2 protein, His-GST-tagged
Cat.No. : | SCG2-4548H |
Product Overview : | Recombinant Human SCG2 protein(P13521)(418-617aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 418-617aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 54.3 kDa |
AA Sequence : | TPGRAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | SCG2 secretogranin II [ Homo sapiens ] |
Official Symbol | SCG2 |
Synonyms | SCG2; secretogranin II; secretogranin-2; CHGC; chromogranin C; secretoneurin; SgII; SN; chromogranin-C; EM66; |
Gene ID | 7857 |
mRNA Refseq | NM_003469 |
Protein Refseq | NP_003460 |
MIM | 118930 |
UniProt ID | P13521 |
◆ Recombinant Proteins | ||
SCG2-5249R | Recombinant Rat SCG2 Protein | +Inquiry |
SCG2-3907R | Recombinant Rhesus Macaque SCG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCG2-4548H | Recombinant Human SCG2 protein, His-GST-tagged | +Inquiry |
Scg2-351M | Recombinant Mouse Scg2 Protein, His-tagged | +Inquiry |
Scg2-353M | Recombinant Mouse Scg2 Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCG2-788HCL | Recombinant Human SCG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCG2 Products
Required fields are marked with *
My Review for All SCG2 Products
Required fields are marked with *