Recombinant Human SCG2 protein, His-GST-tagged
| Cat.No. : | SCG2-4548H |
| Product Overview : | Recombinant Human SCG2 protein(P13521)(418-617aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 418-617aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 54.3 kDa |
| AA Sequence : | TPGRAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | SCG2 secretogranin II [ Homo sapiens ] |
| Official Symbol | SCG2 |
| Synonyms | SCG2; secretogranin II; secretogranin-2; CHGC; chromogranin C; secretoneurin; SgII; SN; chromogranin-C; EM66; |
| Gene ID | 7857 |
| mRNA Refseq | NM_003469 |
| Protein Refseq | NP_003460 |
| MIM | 118930 |
| UniProt ID | P13521 |
| ◆ Recombinant Proteins | ||
| SCG2-6587H | Recombinant Human SCG2 Protein (Ser29-Met617), C-His tagged | +Inquiry |
| SCG2-7930M | Recombinant Mouse SCG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCG2-203H | Recombinant Human SCG2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Scg2-5707M | Recombinant Mouse Scg2 Protein, Myc/DDK-tagged | +Inquiry |
| Scg2-351M | Recombinant Mouse Scg2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCG2-788HCL | Recombinant Human SCG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCG2 Products
Required fields are marked with *
My Review for All SCG2 Products
Required fields are marked with *




