Recombinant Human SCG5 protein(101-170 aa), C-His-tagged
| Cat.No. : | SCG5-2560H |
| Product Overview : | Recombinant Human SCG5 protein(P05408)(101-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 101-170 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYE |
| Gene Name | SCG5 secretogranin V (7B2 protein) [ Homo sapiens ] |
| Official Symbol | SCG5 |
| Synonyms | SCG5; secretogranin V (7B2 protein); secretory granule, neuroendocrine protein 1 (7B2 protein) , SGNE1; neuroendocrine protein 7B2; 7B2; prohormone convertase chaperone; SgV; secretogranin-5; pituitary polypeptide; secretory granule endocrine protein I; secretory granule, neuroendocrine protein 1 (7B2 protein); P7B2; SGNE1; |
| Gene ID | 6447 |
| mRNA Refseq | NM_001144757 |
| Protein Refseq | NP_001138229 |
| MIM | 173120 |
| UniProt ID | P05408 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCG5 Products
Required fields are marked with *
My Review for All SCG5 Products
Required fields are marked with *



