Recombinant Human SCGB2A2, His-tagged
| Cat.No. : | SCGB2A2-29237TH |
| Product Overview : | Recombinant Full length Human Mammaglobin A with an N terminal His tag; 87 amino acids, MWt 9.88kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 75 amino acids |
| Description : | The mammaglobin gene was first identified using a differential screening approach directed at the isolation of novel, human breast cancer-associated genes. |
| Conjugation : | HIS |
| Molecular Weight : | 9.880kDa inclusive of tags |
| Tissue specificity : | Mammary gland specific. Over-expressed in breast cancer. |
| Form : | Lyophilised:Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term sto |
| Storage buffer : | pH: 7.20Constituents:0.29% Sodium chloride, 0.69% Phosphate Buffer |
| Storage : | Store at -80°C |
| Sequences of amino acids : | MRGSHHHHHHGSGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF |
| Sequence Similarities : | Belongs to the secretoglobin family. Lipophilin subfamily. |
| Gene Name | SCGB2A2 secretoglobin, family 2A, member 2 [ Homo sapiens ] |
| Official Symbol | SCGB2A2 |
| Synonyms | SCGB2A2; secretoglobin, family 2A, member 2; mammaglobin 1 , MGB1; mammaglobin-A; mammaglobin A; MGC71974; UGB2; |
| Gene ID | 4250 |
| mRNA Refseq | NM_002411 |
| Protein Refseq | NP_002402 |
| MIM | 605562 |
| Uniprot ID | Q13296 |
| Chromosome Location | 11q13 |
| Function | binding; molecular_function; steroid binding; |
| ◆ Recombinant Proteins | ||
| SCGB2A2-4913R | Recombinant Rat SCGB2A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCGB2A2-2530H | Recombinant Human SCGB2A2, His-tagged | +Inquiry |
| SCGB2A2-30171TH | Recombinant Human SCGB2A2 | +Inquiry |
| SCGB2A2-5254R | Recombinant Rat SCGB2A2 Protein | +Inquiry |
| SCGB2A2-69H | Recombinant Human SCGB2A2 protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCGB2A2-2036HCL | Recombinant Human SCGB2A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGB2A2 Products
Required fields are marked with *
My Review for All SCGB2A2 Products
Required fields are marked with *



