Recombinant Human SCGB2A2 protein, Fc/His-tagged

• Cat.No.: SCGB2A2-524H
• Product Overview: Recombinant Human SCGB2A2 protein (Gly19–Phe93) with C-terminal linker (2 extra AA), TEV site (7 AA), Human IgG1 fragment (Pro100-Lys330, 231 AA) and C-terminal His-tag (6 AA) was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&His
• Protein Length: 19-93 a.a.
• Description: Biased expression in esophagus (RPKM 14.0), fat (RPKM 1.6) and 1 other tissue.
• Molecular Mass: 36.3 kDa
• AA Sequence: GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLFKLENLYFQGPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
• Endotoxin: < 0.1 EU/μg
• Purity: > 95 %
• Applications: WB, ELISA, Cell culture and/or animal studies
• Quality Control Test: BCA to determine quantity of the protein.
  SDS PAGE to determine purity of the protein.
  LAL to determine quantity of endotoxin.
• Storage: Store the lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for 5 days.
• Storage Buffer: Filtered (0.4 μm) and lyophilized from 0.5 mg/mL solution in phosphate buffered saline, 5% w/v trehalose pH 7.4
• Reconstitution: Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
• Shipping: At ambient temperature.

Gene Information

• Gene Name: SCGB2A2 secretoglobin family 2A member 2 [ Homo sapiens (human) ]
• Official Symbol: SCGB2A2
• Synonyms: SCGB2A2; secretoglobin family 2A member 2; MGB1; UGB2; PSBP1; mammaglobin-A; mammaglobin 1; prostatic steroid binding protein 1
• Gene ID: 4250
• mRNA Refseq: NM_002411
• Protein Refseq: NP_002402
• MIM: 605562
• UniProt ID: Q13296