Recombinant Human SCGB2A2 protein, Fc/His-tagged

Cat.No. : SCGB2A2-524H
Product Overview : Recombinant Human SCGB2A2 protein (Gly19–Phe93) with C-terminal linker (2 extra AA), TEV site (7 AA), Human IgG1 fragment (Pro100-Lys330, 231 AA) and C-terminal His-tag (6 AA) was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Protein Length : 19-93 a.a.
Description : Biased expression in esophagus (RPKM 14.0), fat (RPKM 1.6) and 1 other tissue.
Molecular Mass : 36.3 kDa
AA Sequence : GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLFKLENLYFQGPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Endotoxin : < 0.1 EU/μg
Purity : > 95 %
Applications : WB, ELISA, Cell culture and/or animal studies
Quality Control Test : BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
LAL to determine quantity of endotoxin.
Storage : Store the lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for 5 days.
Storage Buffer : Filtered (0.4 μm) and lyophilized from 0.5 mg/mL solution in phosphate buffered saline, 5% w/v trehalose pH 7.4
Reconstitution : Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
Shipping : At ambient temperature.
Gene Name SCGB2A2 secretoglobin family 2A member 2 [ Homo sapiens (human) ]
Official Symbol SCGB2A2
Synonyms SCGB2A2; secretoglobin family 2A member 2; MGB1; UGB2; PSBP1; mammaglobin-A; mammaglobin 1; prostatic steroid binding protein 1
Gene ID 4250
mRNA Refseq NM_002411
Protein Refseq NP_002402
MIM 605562
UniProt ID Q13296

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCGB2A2 Products

Required fields are marked with *

My Review for All SCGB2A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon