Recombinant Human SCGB2A2 protein, Fc/His-tagged
Cat.No. : | SCGB2A2-524H |
Product Overview : | Recombinant Human SCGB2A2 protein (Gly19–Phe93) with C-terminal linker (2 extra AA), TEV site (7 AA), Human IgG1 fragment (Pro100-Lys330, 231 AA) and C-terminal His-tag (6 AA) was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | 19-93 a.a. |
Description : | Biased expression in esophagus (RPKM 14.0), fat (RPKM 1.6) and 1 other tissue. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLFKLENLYFQGPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Endotoxin : | < 0.1 EU/μg |
Purity : | > 95 % |
Applications : | WB, ELISA, Cell culture and/or animal studies |
Quality Control Test : | BCA to determine quantity of the protein. SDS PAGE to determine purity of the protein. LAL to determine quantity of endotoxin. |
Storage : | Store the lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for 5 days. |
Storage Buffer : | Filtered (0.4 μm) and lyophilized from 0.5 mg/mL solution in phosphate buffered saline, 5% w/v trehalose pH 7.4 |
Reconstitution : | Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture. |
Shipping : | At ambient temperature. |
Gene Name | SCGB2A2 secretoglobin family 2A member 2 [ Homo sapiens (human) ] |
Official Symbol | SCGB2A2 |
Synonyms | SCGB2A2; secretoglobin family 2A member 2; MGB1; UGB2; PSBP1; mammaglobin-A; mammaglobin 1; prostatic steroid binding protein 1 |
Gene ID | 4250 |
mRNA Refseq | NM_002411 |
Protein Refseq | NP_002402 |
MIM | 605562 |
UniProt ID | Q13296 |
◆ Recombinant Proteins | ||
SCGB2A2-4913R | Recombinant Rat SCGB2A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCGB2A2-3687H | Recombinant Human SCGB2A2, His-tagged | +Inquiry |
SCGB2A2-854H | Recombinant Human SCGB2A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCGB2A2-4424H | Recombinant Human SCGB2A2 protein, His&Myc-tagged | +Inquiry |
SCGB2A2-524H | Recombinant Human SCGB2A2 protein, Fc/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCGB2A2-2036HCL | Recombinant Human SCGB2A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGB2A2 Products
Required fields are marked with *
My Review for All SCGB2A2 Products
Required fields are marked with *