Recombinant Human SCGB2A2 protein, Fc/His-tagged
| Cat.No. : | SCGB2A2-524H |
| Product Overview : | Recombinant Human SCGB2A2 protein (Gly19–Phe93) with C-terminal linker (2 extra AA), TEV site (7 AA), Human IgG1 fragment (Pro100-Lys330, 231 AA) and C-terminal His-tag (6 AA) was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&His |
| Protein Length : | 19-93 a.a. |
| Description : | Biased expression in esophagus (RPKM 14.0), fat (RPKM 1.6) and 1 other tissue. |
| Molecular Mass : | 36.3 kDa |
| AA Sequence : | GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLFKLENLYFQGPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Endotoxin : | < 0.1 EU/μg |
| Purity : | > 95 % |
| Applications : | WB, ELISA, Cell culture and/or animal studies |
| Quality Control Test : | BCA to determine quantity of the protein. SDS PAGE to determine purity of the protein. LAL to determine quantity of endotoxin. |
| Storage : | Store the lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for 5 days. |
| Storage Buffer : | Filtered (0.4 μm) and lyophilized from 0.5 mg/mL solution in phosphate buffered saline, 5% w/v trehalose pH 7.4 |
| Reconstitution : | Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture. |
| Shipping : | At ambient temperature. |
| Gene Name | SCGB2A2 secretoglobin family 2A member 2 [ Homo sapiens (human) ] |
| Official Symbol | SCGB2A2 |
| Synonyms | SCGB2A2; secretoglobin family 2A member 2; MGB1; UGB2; PSBP1; mammaglobin-A; mammaglobin 1; prostatic steroid binding protein 1 |
| Gene ID | 4250 |
| mRNA Refseq | NM_002411 |
| Protein Refseq | NP_002402 |
| MIM | 605562 |
| UniProt ID | Q13296 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGB2A2 Products
Required fields are marked with *
My Review for All SCGB2A2 Products
Required fields are marked with *
