Recombinant Human SCGB2A2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SCGB2A2-854H | 
| Product Overview : | SCGB2A2 MS Standard C13 and N15-labeled recombinant protein (NP_002402) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | SCGB2A2 (Secretoglobin Family 2A Member 2) is a Protein Coding gene. Diseases associated with SCGB2A2 include Breast Cancer and Lung Cancer Susceptibility 3. An important paralog of this gene is SCGB2A1. | 
| Molecular Mass : | 10.5 kDa | 
| AA Sequence : | MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | SCGB2A2 secretoglobin family 2A member 2 [ Homo sapiens (human) ] | 
| Official Symbol | SCGB2A2 | 
| Synonyms | SCGB2A2; secretoglobin, family 2A, member 2; mammaglobin 1, MGB1; mammaglobin-A; mammaglobin A; MGC71974; UGB2; mammaglobin 1; mammaglobin-1; MGB1; | 
| Gene ID | 4250 | 
| mRNA Refseq | NM_002411 | 
| Protein Refseq | NP_002402 | 
| MIM | 605562 | 
| UniProt ID | Q13296 | 
| ◆ Recombinant Proteins | ||
| SCGB2A2-2530H | Recombinant Human SCGB2A2, His-tagged | +Inquiry | 
| SCGB2A2-4429HFL | Recombinant Full Length Human SCGB2A2 protein, Flag-tagged | +Inquiry | 
| SCGB2A2-29237TH | Recombinant Human SCGB2A2, His-tagged | +Inquiry | 
| SCGB2A2-5838H | Recombinant Human SCGB2A2 protein, His-tagged | +Inquiry | 
| SCGB2A2-854H | Recombinant Human SCGB2A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SCGB2A2-2036HCL | Recombinant Human SCGB2A2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All SCGB2A2 Products
Required fields are marked with *
My Review for All SCGB2A2 Products
Required fields are marked with *
  
        
    
      
            