Recombinant Human SCLY protein, GST-tagged
Cat.No. : | SCLY-301496H |
Product Overview : | Recombinant Human SCLY (1-231 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-His231 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTSKGHTGGHHSPVKGAKPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQTEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGLPPILVH |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SCLY selenocysteine lyase [ Homo sapiens ] |
Official Symbol | SCLY |
Synonyms | SCLY; selenocysteine lyase; putative selenocysteine lyase; SCL; hSCL; |
Gene ID | 51540 |
mRNA Refseq | NM_016510 |
Protein Refseq | NP_057594 |
MIM | 611056 |
UniProt ID | Q96I15 |
◆ Recombinant Proteins | ||
SCLY-6148Z | Recombinant Zebrafish SCLY | +Inquiry |
SCLY-460H | Recombinant Human SCLY Protein, MYC/DDK-tagged | +Inquiry |
SCLY-5213H | Recombinant Human SCLY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCLY-3188H | Recombinant Human SCLY protein, His-tagged | +Inquiry |
SCLY-282H | Recombinant Human SCLY, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCLY-001HCL | Recombinant Human SCLY cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCLY Products
Required fields are marked with *
My Review for All SCLY Products
Required fields are marked with *
0
Inquiry Basket