Recombinant Human SCLY protein, His-tagged
| Cat.No. : | SCLY-3188H |
| Product Overview : | Recombinant Human SCLY protein(1-231 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-231 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTSKGHTGGHHSPVKGAKPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQTEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGLPPILVH |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SCLY selenocysteine lyase [ Homo sapiens ] |
| Official Symbol | SCLY |
| Synonyms | SCLY; selenocysteine lyase; putative selenocysteine lyase; SCL; hSCL; |
| Gene ID | 51540 |
| mRNA Refseq | NM_016510 |
| Protein Refseq | NP_057594 |
| MIM | 611056 |
| UniProt ID | Q96I15 |
| ◆ Recombinant Proteins | ||
| SCLY-14749M | Recombinant Mouse SCLY Protein | +Inquiry |
| SCLY-7934M | Recombinant Mouse SCLY Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCLY-282H | Recombinant Human SCLY, His tagged | +Inquiry |
| Scly-5715M | Recombinant Mouse Scly Protein, Myc/DDK-tagged | +Inquiry |
| SCLY-6148Z | Recombinant Zebrafish SCLY | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCLY-001HCL | Recombinant Human SCLY cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCLY Products
Required fields are marked with *
My Review for All SCLY Products
Required fields are marked with *
