Recombinant Human SCN3B protein, His-tagged
| Cat.No. : | SCN3B-3880H |
| Product Overview : | Recombinant Human SCN3B protein(23-93 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-93 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| ◆ Recombinant Proteins | ||
| SCN3B-645C | Recombinant Cynomolgus Monkey SCN3B Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCN3B-3918R | Recombinant Rhesus Macaque SCN3B Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCN3B-459H | Recombinant Human SCN3B Protein, MYC/DDK-tagged | +Inquiry |
| SCN3B-2339H | Recombinant Human SCN3B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SCN3B-5174Z | Recombinant Zebrafish SCN3B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCN3B-1589HCL | Recombinant Human SCN3B cell lysate | +Inquiry |
| SCN3B-1454HCL | Recombinant Human SCN3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCN3B Products
Required fields are marked with *
My Review for All SCN3B Products
Required fields are marked with *
