Recombinant Human SCO2 protein, His-SUMO-tagged
Cat.No. : | SCO2-3473H |
Product Overview : | Recombinant Human SCO2 protein(O43819)(43-266aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 43-266aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.1 kDa |
AA Sequence : | PAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) [ Homo sapiens ] |
Official Symbol | SCO2 |
Synonyms | SCO2; SCO cytochrome oxidase deficient homolog 2 (yeast); SCO (cytochrome oxidase deficient, yeast) homolog 2; protein SCO2 homolog, mitochondrial; SCO1L; cytochrome oxidase deficient homolog 2; MGC125823; MGC125825; |
Gene ID | 9997 |
mRNA Refseq | NM_001169109 |
Protein Refseq | NP_001162580 |
MIM | 604272 |
UniProt ID | O43819 |
◆ Recombinant Proteins | ||
SCO2-14770M | Recombinant Mouse SCO2 Protein | +Inquiry |
Sco2-170H | Recombinant Human SCO2 | +Inquiry |
SCO2-7942M | Recombinant Mouse SCO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCO2-3149H | Recombinant Human SCO2 protein, His-tagged | +Inquiry |
SCO2-3473H | Recombinant Human SCO2 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCO2-2025HCL | Recombinant Human SCO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCO2 Products
Required fields are marked with *
My Review for All SCO2 Products
Required fields are marked with *
0
Inquiry Basket