Recombinant Human SCOC protein, GST-tagged
| Cat.No. : | SCOC-301258H |
| Product Overview : | Recombinant Human SCOC (45-159 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Glu45-Lys159 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | ENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | SCOC short coiled-coil protein [ Homo sapiens (human) ] |
| Official Symbol | SCOC |
| Synonyms | SCOCO; UNC-69; HRIHFB2072 |
| Gene ID | 60592 |
| mRNA Refseq | NM_001153446 |
| Protein Refseq | NP_001146918 |
| UniProt ID | Q9UIL1 |
| ◆ Recombinant Proteins | ||
| SCOC-3825C | Recombinant Chicken SCOC | +Inquiry |
| SCOC-301258H | Recombinant Human SCOC protein, GST-tagged | +Inquiry |
| SCOC-4249H | Recombinant Human SCOC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Scoc-5719M | Recombinant Mouse Scoc Protein, Myc/DDK-tagged | +Inquiry |
| SCOC-4933R | Recombinant Rat SCOC Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCOC-2024HCL | Recombinant Human SCOC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCOC Products
Required fields are marked with *
My Review for All SCOC Products
Required fields are marked with *
