Recombinant Human SCP2

Cat.No. : SCP2-31466TH
Product Overview : Recombinant full length Human Sterol carrier protein 2, isoform 2 with N-terminal proprietary tag. Predicted MW 41.84 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 143 amino acids
Description : This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.
Molecular Weight : 41.840kDa inclusive of tags
Tissue specificity : Liver, fibroblasts, and placenta.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKL EEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGS VLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLK ITGNMGLAMKLQNLQLQPGNAKL
Sequence Similarities : In the N-terminal section; belongs to the thiolase family.Contains 1 SCP2 domain.
Gene Name SCP2 sterol carrier protein 2 [ Homo sapiens ]
Official Symbol SCP2
Synonyms SCP2; sterol carrier protein 2; non-specific lipid-transfer protein;
Gene ID 6342
mRNA Refseq NM_001007098
Protein Refseq NP_001007099
MIM 184755
Uniprot ID P22307
Chromosome Location 1p32
Pathway Beta-oxidation of pristanoyl-CoA, organism-specific biosystem; Bile acid and bile salt metabolism, organism-specific biosystem; Bile acid biosynthesis, cholesterol => chenodeoxycholate, organism-specific biosystem; Bile acid biosynthesis, cholesterol =>
Function catalytic activity; lipid binding; propanoyl-CoA C-acyltransferase activity; protein binding; sterol binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCP2 Products

Required fields are marked with *

My Review for All SCP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon