Recombinant Human SCP2
| Cat.No. : | SCP2-31466TH |
| Product Overview : | Recombinant full length Human Sterol carrier protein 2, isoform 2 with N-terminal proprietary tag. Predicted MW 41.84 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 143 amino acids |
| Description : | This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. |
| Molecular Weight : | 41.840kDa inclusive of tags |
| Tissue specificity : | Liver, fibroblasts, and placenta. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKL EEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGS VLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLK ITGNMGLAMKLQNLQLQPGNAKL |
| Sequence Similarities : | In the N-terminal section; belongs to the thiolase family.Contains 1 SCP2 domain. |
| Gene Name | SCP2 sterol carrier protein 2 [ Homo sapiens ] |
| Official Symbol | SCP2 |
| Synonyms | SCP2; sterol carrier protein 2; non-specific lipid-transfer protein; |
| Gene ID | 6342 |
| mRNA Refseq | NM_001007098 |
| Protein Refseq | NP_001007099 |
| MIM | 184755 |
| Uniprot ID | P22307 |
| Chromosome Location | 1p32 |
| Pathway | Beta-oxidation of pristanoyl-CoA, organism-specific biosystem; Bile acid and bile salt metabolism, organism-specific biosystem; Bile acid biosynthesis, cholesterol => chenodeoxycholate, organism-specific biosystem; Bile acid biosynthesis, cholesterol => |
| Function | catalytic activity; lipid binding; propanoyl-CoA C-acyltransferase activity; protein binding; sterol binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCP2 Products
Required fields are marked with *
My Review for All SCP2 Products
Required fields are marked with *
