Recombinant Human SCP2 protein, His-tagged
Cat.No. : | SCP2-3711H |
Product Overview : | Recombinant Human SCP2 protein(405-547 aa), fused to His tag, was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 405-547 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SCP2 sterol carrier protein 2 [ Homo sapiens ] |
Official Symbol | SCP2 |
Synonyms | SCP2; sterol carrier protein 2; non-specific lipid-transfer protein; sterol carrier protein X; propanoyl-CoA C-acyltransferase; NLTP; SCPX; SCP-2; SCP-X; NSL-TP; SCP-CHI; DKFZp686C12188; DKFZp686D11188; |
Gene ID | 6342 |
mRNA Refseq | NM_001007098 |
Protein Refseq | NP_001007099 |
MIM | 184755 |
UniProt ID | P22307 |
◆ Recombinant Proteins | ||
SCP2-4588H | Recombinant Human SCP2 protein, His-tagged | +Inquiry |
Scp2-2045M | Recombinant Mouse Scp2 Protein, His&GST-tagged | +Inquiry |
Scp2-5720M | Recombinant Mouse Scp2 Protein, Myc/DDK-tagged | +Inquiry |
SCP2-4934R | Recombinant Rat SCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCP2-31466TH | Recombinant Human SCP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCP2-2023HCL | Recombinant Human SCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCP2 Products
Required fields are marked with *
My Review for All SCP2 Products
Required fields are marked with *