Recombinant Human SCP2 protein, His-tagged
| Cat.No. : | SCP2-3711H |
| Product Overview : | Recombinant Human SCP2 protein(405-547 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 405-547 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SCP2 sterol carrier protein 2 [ Homo sapiens ] |
| Official Symbol | SCP2 |
| Synonyms | SCP2; sterol carrier protein 2; non-specific lipid-transfer protein; sterol carrier protein X; propanoyl-CoA C-acyltransferase; NLTP; SCPX; SCP-2; SCP-X; NSL-TP; SCP-CHI; DKFZp686C12188; DKFZp686D11188; |
| Gene ID | 6342 |
| mRNA Refseq | NM_001007098 |
| Protein Refseq | NP_001007099 |
| MIM | 184755 |
| UniProt ID | P22307 |
| ◆ Recombinant Proteins | ||
| SCP2-7944M | Recombinant Mouse SCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCP2-31466TH | Recombinant Human SCP2 | +Inquiry |
| SCP2-2477H | Recombinant Human SCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SCP2-7865H | Recombinant Human SCP2 protein, GST-tagged | +Inquiry |
| SCP2-14772M | Recombinant Mouse SCP2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCP2-2023HCL | Recombinant Human SCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCP2 Products
Required fields are marked with *
My Review for All SCP2 Products
Required fields are marked with *
