Recombinant Human SDCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SDCBP2-1081H |
| Product Overview : | SDCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_056500) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene contains two class II PDZ domains. PDZ domains facilitate protein-protein interactions by binding to the cytoplasmic C-terminus of transmembrane proteins, and PDZ-containing proteins mediate cell signaling and the organization of protein complexes. The encoded protein binds to phosphatidylinositol 4, 5-bisphosphate (PIP2) and plays a role in nuclear PIP2 organization and cell division. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Read-through transcription also exists between this gene and the upstream FKBP1A (FK506 binding protein 1A, 12kDa) gene, as represented in GeneID:100528031. |
| Molecular Mass : | 22.5 kDa |
| AA Sequence : | MVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SDCBP2 syndecan binding protein 2 [ Homo sapiens (human) ] |
| Official Symbol | SDCBP2 |
| Synonyms | SDCBP2; syndecan binding protein (syntenin) 2; syntenin-2; SITAC18; ST 2; ST-2; SITAC; FLJ12256; |
| Gene ID | 27111 |
| mRNA Refseq | NM_015685 |
| Protein Refseq | NP_056500 |
| MIM | 617358 |
| UniProt ID | Q9H190 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDCBP2 Products
Required fields are marked with *
My Review for All SDCBP2 Products
Required fields are marked with *



