Recombinant Human SDCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SDCBP2-1081H |
Product Overview : | SDCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_056500) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene contains two class II PDZ domains. PDZ domains facilitate protein-protein interactions by binding to the cytoplasmic C-terminus of transmembrane proteins, and PDZ-containing proteins mediate cell signaling and the organization of protein complexes. The encoded protein binds to phosphatidylinositol 4, 5-bisphosphate (PIP2) and plays a role in nuclear PIP2 organization and cell division. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Read-through transcription also exists between this gene and the upstream FKBP1A (FK506 binding protein 1A, 12kDa) gene, as represented in GeneID:100528031. |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SDCBP2 syndecan binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | SDCBP2 |
Synonyms | SDCBP2; syndecan binding protein (syntenin) 2; syntenin-2; SITAC18; ST 2; ST-2; SITAC; FLJ12256; |
Gene ID | 27111 |
mRNA Refseq | NM_015685 |
Protein Refseq | NP_056500 |
MIM | 617358 |
UniProt ID | Q9H190 |
◆ Recombinant Proteins | ||
SDCBP2-4038H | Recombinant Human SDCBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SDCBP2-1081H | Recombinant Human SDCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SDCBP2-385H | Recombinant Human syndecan binding protein (syntenin) 2, His-tagged | +Inquiry |
SDCBP2-2549H | Recombinant Human SDCBP2, His-tagged | +Inquiry |
SDCBP2-1360H | Recombinant Human SDCBP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDCBP2-2014HCL | Recombinant Human SDCBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SDCBP2 Products
Required fields are marked with *
My Review for All SDCBP2 Products
Required fields are marked with *
0
Inquiry Basket