Recombinant Human SDHAF4 Protein, GST-Tagged
| Cat.No. : | SDHAF4-0125H |
| Product Overview : | Human SDHAF4 full-length ORF (NP_660310.2, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | SDHAF4 (Succinate Dehydrogenase Complex Assembly Factor 4) is a Protein Coding gene. |
| Molecular Mass : | 38.28 kDa |
| AA Sequence : | MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPMLPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SDHAF4 succinate dehydrogenase complex assembly factor 4 [ Homo sapiens (human) ] |
| Official Symbol | SDHAF4 |
| Synonyms | SDHAF4; succinate dehydrogenase complex assembly factor 4; Sdh8; C6orf57; Succinate Dehydrogenase Complex Assembly Factor 4; SDH Assembly Factor 4; Succinate Dehydrogenase Assembly Factor 4, Mitochondrial; Chromosome 6 Open Reading Frame 57; UPF0369 Protein C6orf57 |
| Gene ID | 135154 |
| mRNA Refseq | NM_145267 |
| Protein Refseq | NP_660310 |
| UniProt ID | Q5VUM1 |
| ◆ Recombinant Proteins | ||
| SDHAF4-0125H | Recombinant Human SDHAF4 Protein, GST-Tagged | +Inquiry |
| SDHAF4-2708HF | Recombinant Full Length Human SDHAF4 Protein, GST-tagged | +Inquiry |
| SDHAF4-531H | Recombinant Human SDHAF4 Protein, MYC/DDK-tagged | +Inquiry |
| Sdhaf4-5733M | Recombinant Mouse Sdhaf4 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDHAF4 Products
Required fields are marked with *
My Review for All SDHAF4 Products
Required fields are marked with *
