Recombinant Human SDR9C7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SDR9C7-1996H
Product Overview : SDR9C7 MS Standard C13 and N15-labeled recombinant protein (NP_683695) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein with similarity to the short-chain dehydrogenase/reductase (SDR) family but has not been shown to have retinoid or dehydrogenase activities.
Molecular Mass : 35.3 kDa
AA Sequence : MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTSYRLQTTLLDVTKSESIKAAAQWVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEVTLHMLPMVKRARGRVVNMSSSGGRVAVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAILGKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SDR9C7 short chain dehydrogenase/reductase family 9C member 7 [ Homo sapiens (human) ]
Official Symbol SDR9C7
Synonyms SDR9C7; short chain dehydrogenase/reductase family 9C, member 7; short-chain dehydrogenase/reductase family 9C member 7; RDHS; SDR O; RDH-S; retinol dehydrogenase similar protein; orphan short-chain dehydrogenase/reductase; orphan short-chain dehydrogenase / reductase; SDRO; SDR-O; FLJ16333; MGC126600; MGC126602;
Gene ID 121214
mRNA Refseq NM_148897
Protein Refseq NP_683695
MIM 609769
UniProt ID Q8NEX9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDR9C7 Products

Required fields are marked with *

My Review for All SDR9C7 Products

Required fields are marked with *

0
cart-icon
0
compare icon