Recombinant Human SDR9C7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SDR9C7-1996H |
Product Overview : | SDR9C7 MS Standard C13 and N15-labeled recombinant protein (NP_683695) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein with similarity to the short-chain dehydrogenase/reductase (SDR) family but has not been shown to have retinoid or dehydrogenase activities. |
Molecular Mass : | 35.3 kDa |
AA Sequence : | MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTSYRLQTTLLDVTKSESIKAAAQWVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEVTLHMLPMVKRARGRVVNMSSSGGRVAVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAILGKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SDR9C7 short chain dehydrogenase/reductase family 9C member 7 [ Homo sapiens (human) ] |
Official Symbol | SDR9C7 |
Synonyms | SDR9C7; short chain dehydrogenase/reductase family 9C, member 7; short-chain dehydrogenase/reductase family 9C member 7; RDHS; SDR O; RDH-S; retinol dehydrogenase similar protein; orphan short-chain dehydrogenase/reductase; orphan short-chain dehydrogenase / reductase; SDRO; SDR-O; FLJ16333; MGC126600; MGC126602; |
Gene ID | 121214 |
mRNA Refseq | NM_148897 |
Protein Refseq | NP_683695 |
MIM | 609769 |
UniProt ID | Q8NEX9 |
◆ Recombinant Proteins | ||
Sdr9c7-5736M | Recombinant Mouse Sdr9c7 Protein, Myc/DDK-tagged | +Inquiry |
SDR9C7-1996H | Recombinant Human SDR9C7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SDR9C7-14814M | Recombinant Mouse SDR9C7 Protein | +Inquiry |
SDR9C7-7977M | Recombinant Mouse SDR9C7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDR9C7-2005HCL | Recombinant Human SDR9C7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDR9C7 Products
Required fields are marked with *
My Review for All SDR9C7 Products
Required fields are marked with *