Recombinant Human SDS protein, His&Myc-tagged
Cat.No. : | SDS-5644H |
Product Overview : | Recombinant Human SDS protein(P20132)(1-328aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-328aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK |
Gene Name | SDS serine dehydratase [ Homo sapiens ] |
Official Symbol | SDS |
Synonyms | SDS; serine dehydratase; L-serine dehydratase/L-threonine deaminase; SDH; TDH; L-serine deaminase; L-serine dehydratase; L-serine ammonia-lyase; L-threonine dehydratase; |
Gene ID | 10993 |
mRNA Refseq | NM_006843 |
Protein Refseq | NP_006834 |
MIM | 182128 |
UniProt ID | P20132 |
◆ Recombinant Proteins | ||
Sds-5737M | Recombinant Mouse Sds Protein, Myc/DDK-tagged | +Inquiry |
SDS-4118R | Recombinant Rhesus monkey SDS Protein, His-tagged | +Inquiry |
SDS-2555H | Recombinant Human SDS, His-tagged | +Inquiry |
SDS-3935R | Recombinant Rhesus Macaque SDS Protein, His (Fc)-Avi-tagged | +Inquiry |
SDS-5644H | Recombinant Human SDS protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDS-2004HCL | Recombinant Human SDS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDS Products
Required fields are marked with *
My Review for All SDS Products
Required fields are marked with *
0
Inquiry Basket