Recombinant Human SEC24A protein, GST-tagged
Cat.No. : | SEC24A-46H |
Product Overview : | Recombinant Human SEC24A(301 a.a. - 390 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 301-390 a.a. |
Description : | The protein encoded by this gene belongs to a family of proteins that are homologous to yeast Sec24. This protein is a component of coat protein II (COPII)-coated vesicles that mediate protein transport from the endoplasmic reticulum. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the golgi complex. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.64 kDa |
AA Sequence : | PLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQ NTTPPGATGVPPSSL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SEC24A SEC24 family, member A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SEC24A |
Synonyms | SEC24A; SEC24 family, member A (S. cerevisiae); SEC24 (S. cerevisiae) related gene family, member A; protein transport protein Sec24A; SEC24-related protein A; SEC24 related gene family, member A; |
Gene ID | 10802 |
mRNA Refseq | NM_001252231 |
Protein Refseq | NP_001239160 |
MIM | 607183 |
UniProt ID | O95486 |
Chromosome Location | 5q31.1 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen Presentation: Folding, assembly and peptide loading of class I MHC, organism-specific biosystem; Asparagine N-linked glycosylation, organism-specific biosystem; COPII (Coat Protein 2) Mediated Vesicle Transport, organism-specific biosystem; COPII complex, organism-specific biosystem; Class I MHC mediated antigen processing and presentation, organism-specific biosystem; |
Function | molecular_function; zinc ion binding; |
◆ Recombinant Proteins | ||
SEC24A-7988M | Recombinant Mouse SEC24A Protein, His (Fc)-Avi-tagged | +Inquiry |
SEC24A-14832M | Recombinant Mouse SEC24A Protein | +Inquiry |
SEC24A-46H | Recombinant Human SEC24A protein, GST-tagged | +Inquiry |
SEC24A-2565H | Recombinant Human SEC24A, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEC24A Products
Required fields are marked with *
My Review for All SEC24A Products
Required fields are marked with *