Recombinant Human SEC24A protein, GST-tagged

Cat.No. : SEC24A-46H
Product Overview : Recombinant Human SEC24A(301 a.a. - 390 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 301-390 a.a.
Description : The protein encoded by this gene belongs to a family of proteins that are homologous to yeast Sec24. This protein is a component of coat protein II (COPII)-coated vesicles that mediate protein transport from the endoplasmic reticulum. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the golgi complex. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.64 kDa
AA Sequence : PLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQ NTTPPGATGVPPSSL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SEC24A SEC24 family, member A (S. cerevisiae) [ Homo sapiens ]
Official Symbol SEC24A
Synonyms SEC24A; SEC24 family, member A (S. cerevisiae); SEC24 (S. cerevisiae) related gene family, member A; protein transport protein Sec24A; SEC24-related protein A; SEC24 related gene family, member A;
Gene ID 10802
mRNA Refseq NM_001252231
Protein Refseq NP_001239160
MIM 607183
UniProt ID O95486
Chromosome Location 5q31.1
Pathway Adaptive Immune System, organism-specific biosystem; Antigen Presentation: Folding, assembly and peptide loading of class I MHC, organism-specific biosystem; Asparagine N-linked glycosylation, organism-specific biosystem; COPII (Coat Protein 2) Mediated Vesicle Transport, organism-specific biosystem; COPII complex, organism-specific biosystem; Class I MHC mediated antigen processing and presentation, organism-specific biosystem;
Function molecular_function; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SEC24A Products

Required fields are marked with *

My Review for All SEC24A Products

Required fields are marked with *

0
cart-icon