Recombinant Human SECTM1 Protein, His-tagged

Species :	Human
Source :	HEK293
Tag :	His
Protein Length :	248
Description :	This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
Form :	Lyophilized
Molecular Mass :	13.5 kDa
AA Sequence :	MQTCPLAFPGHVSQALGTLLFLAASLSAQNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP
Purity :	> 98%
Applications :	WB; ELISA; FACS; FC
Stability :	This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage :	At -20 centigrade.
Concentration :	1 mg/mL
Storage Buffer :	PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution :	Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Name	SECTM1 secreted and transmembrane 1 [ Homo sapiens (human) ]
Official Symbol	SECTM1
Synonyms	SECTM1; secreted and transmembrane 1; secreted and transmembrane protein 1; K12; K12 protein; type 1a transmembrane protein;
Gene ID	6398
mRNA Refseq	NM_003004
Protein Refseq	NP_002995
MIM	602602
UniProt ID	Q8WVN6