Recombinant Human SECTM1 Protein, His-tagged
Cat.No. : | SECTM1-438H |
Product Overview : | Recombinant human SECTM1 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 248 |
Description : | This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes. |
Form : | Lyophilized |
Molecular Mass : | 13.5 kDa |
AA Sequence : | MQTCPLAFPGHVSQALGTLLFLAASLSAQNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | SECTM1 secreted and transmembrane 1 [ Homo sapiens (human) ] |
Official Symbol | SECTM1 |
Synonyms | SECTM1; secreted and transmembrane 1; secreted and transmembrane protein 1; K12; K12 protein; type 1a transmembrane protein; |
Gene ID | 6398 |
mRNA Refseq | NM_003004 |
Protein Refseq | NP_002995 |
MIM | 602602 |
UniProt ID | Q8WVN6 |
◆ Recombinant Proteins | ||
SECTM1-3967H | Recombinant Human SECTM1 protein, His-tagged | +Inquiry |
SECTM1-2571H | Recombinant Human SECTM1, His-tagged | +Inquiry |
SECTM1-1947H | Recombinant Human SECTM1 protein, His & GST-tagged | +Inquiry |
SECTM1-4550H | Recombinant Human SECTM1 protein, hFc-tagged | +Inquiry |
SECTM1-1273H | Active Recombinant Human SECTM1 protein, hFc&His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SECTM1-1946HCL | Recombinant Human SECTM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SECTM1 Products
Required fields are marked with *
My Review for All SECTM1 Products
Required fields are marked with *
0
Inquiry Basket