Recombinant Human SELL protein, His-tagged

• Cat.No.: SELL-2810H
• Product Overview: Recombinant Human SELL protein(233-375 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 233-375 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: SSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGM
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SELL selectin L [ Homo sapiens ]
• Official Symbol: SELL
• Synonyms: SELL; selectin L; LNHR, LYAM1, lymphocyte adhesion molecule 1; L-selectin; CD62L; hLHRc; LAM 1; LAM1; Leu 8; LSEL; Lyam 1; PLNHR; gp90-MEL; pln homing receptor; lymph node homing receptor; lymphocyte adhesion molecule 1; leukocyte surface antigen Leu-8; CD62 antigen-like family member L; leukocyte-endothelial cell adhesion molecule 1; TQ1; LEU8; LNHR; LYAM1; LECAM1
• Gene ID: 6402
• mRNA Refseq: NM_000655
• Protein Refseq: NP_000646
• MIM: 153240
• UniProt ID: P14151