Recombinant Human SELL protein, His-tagged
| Cat.No. : | SELL-2810H |
| Product Overview : | Recombinant Human SELL protein(233-375 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 233-375 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGM |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SELL selectin L [ Homo sapiens ] |
| Official Symbol | SELL |
| Synonyms | SELL; selectin L; LNHR, LYAM1, lymphocyte adhesion molecule 1; L-selectin; CD62L; hLHRc; LAM 1; LAM1; Leu 8; LSEL; Lyam 1; PLNHR; gp90-MEL; pln homing receptor; lymph node homing receptor; lymphocyte adhesion molecule 1; leukocyte surface antigen Leu-8; CD62 antigen-like family member L; leukocyte-endothelial cell adhesion molecule 1; TQ1; LEU8; LNHR; LYAM1; LECAM1; |
| Gene ID | 6402 |
| mRNA Refseq | NM_000655 |
| Protein Refseq | NP_000646 |
| MIM | 153240 |
| UniProt ID | P14151 |
| ◆ Recombinant Proteins | ||
| RFL35914RF | Recombinant Full Length Rat L-Selectin(Sell) Protein, His-Tagged | +Inquiry |
| SELL-2658H | Active Recombinant Human Selectin L | +Inquiry |
| SELL-1262H | Recombinant Human SELL protein, hFc&His-tagged | +Inquiry |
| SELL-279H | Recombinant Human L-Selectin,His-tagged | +Inquiry |
| SELL-2810H | Recombinant Human SELL protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SELL-1131CCL | Recombinant Cynomolgus SELL cell lysate | +Inquiry |
| SELL-2614MCL | Recombinant Mouse SELL cell lysate | +Inquiry |
| SELL-1963HCL | Recombinant Human SELL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SELL Products
Required fields are marked with *
My Review for All SELL Products
Required fields are marked with *
