"SELPLG" Related Products

Expand
Expand
Expand

Recombinant Human SELPLG protein, T7/His-tagged

Cat.No.: SELPLG-93H
Product Overview: Recombinant human CD162 cDNA (18 – 320 aa, Isoform-II, derived from BC029782), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGTRLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEML RNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVP TEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQT TPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSV SSVTHKGIPMAASNLSVNYPVGAPDHISVKQC
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro non-glycosylated CD162 protein mediated P-selectin related tumor metastasis regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CD162 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: SELPLG selectin P ligand [ Homo sapiens ]
Official Symbol: SELPLG
Synonyms: SELPLG; selectin P ligand; P-selectin glycoprotein ligand 1; CD162; PSGL 1; cutaneous lymphocyte-associated associated antigen; CLA; PSGL1; PSGL-1;
Gene ID: 6404
mRNA Refseq: NM_001206609
Protein Refseq: NP_001193538
MIM: 600738
UniProt ID: Q14242
Chromosome Location: 12q24
Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Staphylococcus aureus infection, organism-specific biosystem
Function: bacterial cell surface binding; protein binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.