Recombinant Human SELPLG protein, T7/His-tagged
| Cat.No. : | SELPLG-93H |
| Product Overview : | Recombinant human CD162 cDNA (18 – 320 aa, Isoform-II, derived from BC029782), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 18-320 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGTRLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEML RNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVP TEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQT TPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSV SSVTHKGIPMAASNLSVNYPVGAPDHISVKQC |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro non-glycosylated CD162 protein mediated P-selectin related tumor metastasis regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CD162 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | SELPLG selectin P ligand [ Homo sapiens ] |
| Official Symbol | SELPLG |
| Synonyms | SELPLG; selectin P ligand; P-selectin glycoprotein ligand 1; CD162; PSGL 1; cutaneous lymphocyte-associated associated antigen; CLA; PSGL1; PSGL-1; |
| Gene ID | 6404 |
| mRNA Refseq | NM_001206609 |
| Protein Refseq | NP_001193538 |
| MIM | 600738 |
| UniProt ID | Q14242 |
| Chromosome Location | 12q24 |
| Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Staphylococcus aureus infection, organism-specific biosystem |
| Function | bacterial cell surface binding; protein binding; receptor binding; |
| ◆ Recombinant Proteins | ||
| SELPLG-03H | Recombinant Human SELPLG Protein, hIgG/His-tagged | +Inquiry |
| SELPLG-001H | Recombinant Human selectin P ligand Protein, His tagged | +Inquiry |
| Selplg-1773M | Recombinant Mouse Selectin, Platelet (P-selectin) Ligand | +Inquiry |
| SELPLG-8221Z | Recombinant Zebrafish SELPLG | +Inquiry |
| Selplg-528M | Recombinant Mouse Selplg | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SELPLG-1089HCL | Recombinant Human SELPLG cell lysate | +Inquiry |
| SELPLG-001MCL | Recombinant Mouse SELPLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SELPLG Products
Required fields are marked with *
My Review for All SELPLG Products
Required fields are marked with *
