Recombinant Human SELPLG Protein, hIgG/His-tagged

Cat.No. : SELPLG-03H
Product Overview : Recombinant human PSGL-1 (496aa), fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Protein Length : 42-295
Description : This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants.
Form : Liquid
Molecular Mass : 53.4 kDa
AA Sequence : QATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAASNLSV
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : >90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determinedby Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name SELPLG selectin P ligand [ Homo sapiens (human) ]
Official Symbol SELPLG
Synonyms SELPLG; selectin P ligand; CLA; CD162; PSGL1; PSGL-1; P-selectin glycoprotein ligand 1; cutaneous lymphocyte-associated associated antigen
Gene ID 6404
mRNA Refseq NM_003006
Protein Refseq NP_002997
MIM 600738
UniProt ID Q14242

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SELPLG Products

Required fields are marked with *

My Review for All SELPLG Products

Required fields are marked with *

0
cart-icon