| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
Fc&His |
| Protein Length : |
42-295 |
| Description : |
This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants. |
| Form : |
Liquid |
| Molecular Mass : |
53.4 kDa |
| AA Sequence : |
QATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAASNLSV |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
>90% by SDS-PAGE |
| Applications : |
SDS-PAGE |
| Storage : |
Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
1 mg/mL (determinedby Absorbance at 280nm) |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |