Recombinant Human SEMG1 Protein, His-SUMO-tagged
Cat.No. : | SEMG1-1368H |
Product Overview : | Recombinant Human SEMG1 Protein (24-402aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-402 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 58.8 kDa |
AA Sequence : | QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | SEMG1 semenogelin I [ Homo sapiens ] |
Official Symbol | SEMG1 |
Synonyms | SEMG1; semenogelin I; SEMG; semenogelin-1; cancer/testis antigen 103; CT103; semen coagulating protein; SGI; dJ172H20.2; FLJ78262; MGC14719 |
Gene ID | 6406 |
mRNA Refseq | NM_003007 |
Protein Refseq | NP_002998 |
MIM | 182140 |
UniProt ID | P04279 |
◆ Recombinant Proteins | ||
SEMG1-6262H | Recombinant Human SEMG1 Protein (Gln24-Thr402), C-His tagged | +Inquiry |
SEMG1-221H | Recombinant Human SEMG1 Protein, His-tagged | +Inquiry |
SEMG1-7760H | Recombinant Human SEMG1, His-tagged | +Inquiry |
SEMG1-7640H | Recombinant Human SEMG1, His-tagged | +Inquiry |
SEMG1-1368H | Recombinant Human SEMG1 Protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEMG1-1977HCL | Recombinant Human SEMG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SEMG1 Products
Required fields are marked with *
My Review for All SEMG1 Products
Required fields are marked with *
0
Inquiry Basket