Recombinant Human SEMG1 Protein, His-SUMO-tagged
| Cat.No. : | SEMG1-1368H | 
| Product Overview : | Recombinant Human SEMG1 Protein (24-402aa) was expressed in E. coli with N-terminal His-SUMO tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 24-402 a.a. | 
| Form : | Tris-based buffer, 50% glycerol. | 
| Molecular Mass : | 58.8 kDa | 
| AA Sequence : | QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
| Gene Name | SEMG1 semenogelin I [ Homo sapiens ] | 
| Official Symbol | SEMG1 | 
| Synonyms | SEMG1; semenogelin I; SEMG; semenogelin-1; cancer/testis antigen 103; CT103; semen coagulating protein; SGI; dJ172H20.2; FLJ78262; MGC14719 | 
| Gene ID | 6406 | 
| mRNA Refseq | NM_003007 | 
| Protein Refseq | NP_002998 | 
| MIM | 182140 | 
| UniProt ID | P04279 | 
| ◆ Recombinant Proteins | ||
| SEMG1-221H | Recombinant Human SEMG1 Protein, His-tagged | +Inquiry | 
| SEMG1-7760H | Recombinant Human SEMG1, His-tagged | +Inquiry | 
| SEMG1-6262H | Recombinant Human SEMG1 Protein (Gln24-Thr402), C-His tagged | +Inquiry | 
| SEMG1-698H | Recombinant Human SEMG1 Protein, His-tagged | +Inquiry | 
| SEMG1-7640H | Recombinant Human SEMG1, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SEMG1-1977HCL | Recombinant Human SEMG1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEMG1 Products
Required fields are marked with *
My Review for All SEMG1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            