Recombinant Human SENP2 protein, GST-tagged
| Cat.No. : | SENP2-6754H |
| Product Overview : | Recombinant Human SENP2 protein(78-228 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 78-228 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | TKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLGNKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGH |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | SENP2 SUMO1/sentrin/SMT3 specific peptidase 2 [ Homo sapiens ] |
| Official Symbol | SENP2 |
| Synonyms | SENP2; SUMO1/sentrin/SMT3 specific peptidase 2; SUMO1/sentrin/SMT3 specific protease 2; sentrin-specific protease 2; AXAM2; DKFZp762A2316; KIAA1331; SMT3IP2; SMT3-specific isopeptidase 2; sentrin/SUMO-specific protease SENP2; |
| mRNA Refseq | NM_021627 |
| Protein Refseq | NP_067640 |
| MIM | 608261 |
| UniProt ID | Q9HC62 |
| Gene ID | 59343 |
| ◆ Recombinant Proteins | ||
| SENP2-6153H | Recombinant Human SENP2 Protein (Asp363-Leu589), N-His and SUMO tagged | +Inquiry |
| SENP2-689H | Active Recombinant Human SENP2, His-tagged | +Inquiry |
| SENP2-29695TH | Active Recombinant Human SENP2 Protein, His tagged | +Inquiry |
| SENP2-32H | Recombinant Human SENP2 protein | +Inquiry |
| SENP2-8014M | Recombinant Mouse SENP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SENP2-583HCL | Recombinant Human SENP2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SENP2 Products
Required fields are marked with *
My Review for All SENP2 Products
Required fields are marked with *
