Recombinant Human SERF2 protein, GST-tagged
| Cat.No. : | SERF2-2586H |
| Product Overview : | Recombinant Human SERF2 protein(1-59 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | December 08, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-59 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| ◆ Recombinant Proteins | ||
| SERF2-2586H | Recombinant Human SERF2 protein, GST-tagged | +Inquiry |
| SERF2-14904M | Recombinant Mouse SERF2 Protein | +Inquiry |
| SERF2-233H | Recombinant Human SERF2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SERF2-286H | Recombinant Human small EDRK-rich factor 2, His-tagged | +Inquiry |
| SERF2-7475Z | Recombinant Zebrafish SERF2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERF2-1947HCL | Recombinant Human SERF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERF2 Products
Required fields are marked with *
My Review for All SERF2 Products
Required fields are marked with *
