Recombinant Human SERGEF Protein, GST-tagged
Cat.No. : | SERGEF-2530H |
Product Overview : | Human DELGEF partial ORF ( NP_036271, 240 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SERGEF (Secretion Regulating Guanine Nucleotide Exchange Factor) is a Protein Coding gene. GO annotations related to this gene include Ran guanyl-nucleotide exchange factor activity. An important paralog of this gene is IBTK. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | KHGQLANEAAFLPVPQKIEAHCFQNEKVTAIWSGWTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SERGEF secretion regulating guanine nucleotide exchange factor [ Homo sapiens ] |
Official Symbol | SERGEF |
Synonyms | SERGEF; secretion regulating guanine nucleotide exchange factor; secretion-regulating guanine nucleotide exchange factor; DelGEF; Gnefr; guanine nucleotide exchange factor-related protein; deafness locus associated putative guanine nucleotide exchange factor; deafness locus-associated putative guanine nucleotide exchange factor; DELGEF; |
Gene ID | 26297 |
mRNA Refseq | NM_012139 |
Protein Refseq | NP_036271 |
MIM | 606051 |
UniProt ID | Q9UGK8 |
◆ Recombinant Proteins | ||
SERGEF-5265H | Recombinant Human SERGEF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Sergef-5778M | Recombinant Mouse Sergef Protein, Myc/DDK-tagged | +Inquiry |
SERGEF-8034M | Recombinant Mouse SERGEF Protein, His (Fc)-Avi-tagged | +Inquiry |
SERGEF-867H | Recombinant Human SERGEF Protein, MYC/DDK-tagged | +Inquiry |
SERGEF-3858H | Recombinant Human SERGEF protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERGEF Products
Required fields are marked with *
My Review for All SERGEF Products
Required fields are marked with *
0
Inquiry Basket