Recombinant Human SERGEF Protein, GST-tagged

• Cat.No.: SERGEF-2530H
• Product Overview: Human DELGEF partial ORF ( NP_036271, 240 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SERGEF (Secretion Regulating Guanine Nucleotide Exchange Factor) is a Protein Coding gene. GO annotations related to this gene include Ran guanyl-nucleotide exchange factor activity. An important paralog of this gene is IBTK.
• Molecular Mass: 36.52 kDa
• AA Sequence: KHGQLANEAAFLPVPQKIEAHCFQNEKVTAIWSGWTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SERGEF secretion regulating guanine nucleotide exchange factor [ Homo sapiens ]
• Official Symbol: SERGEF
• Synonyms: SERGEF; secretion regulating guanine nucleotide exchange factor; secretion-regulating guanine nucleotide exchange factor; DelGEF; Gnefr; guanine nucleotide exchange factor-related protein; deafness locus associated putative guanine nucleotide exchange factor; deafness locus-associated putative guanine nucleotide exchange factor; DELGEF
• Gene ID: 26297
• mRNA Refseq: NM_012139
• Protein Refseq: NP_036271
• MIM: 606051
• UniProt ID: Q9UGK8