Recombinant Human Serine/Threonine Kinase 38, His-tagged

Cat.No. : STK38-1179H
Product Overview : Recombinant Human Serine/Threonine Kinase 38(116 - 465 aa), fused with His tag, was expressed in E. coli.
Availability September 04, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 116 - 465 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : AMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name STK38 serine/threonine kinase 38 [ Homo sapiens ]
Official Symbol STK38
Synonyms STK38; serine/threonine kinase 38; serine/threonine-protein kinase 38; NDR; NDR1 protein kinase; nuclear Dbf2-related 1; nuclear Dbf2-related kinase 1; Ndr Ser/Thr kinase-like protein; serine threonine protein kinase; NDR1;
Gene ID 11329
mRNA Refseq NM_007271
Protein Refseq NP_009202
MIM 606964
UniProt ID Q15208

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STK38 Products

Required fields are marked with *

My Review for All STK38 Products

Required fields are marked with *

0
cart-icon
0
compare icon