Recombinant Human Serine/Threonine Kinase 38, His-tagged
Cat.No. : | STK38-1179H |
Product Overview : | Recombinant Human Serine/Threonine Kinase 38(116 - 465 aa), fused with His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 116 - 465 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | STK38 serine/threonine kinase 38 [ Homo sapiens ] |
Official Symbol | STK38 |
Synonyms | STK38; serine/threonine kinase 38; serine/threonine-protein kinase 38; NDR; NDR1 protein kinase; nuclear Dbf2-related 1; nuclear Dbf2-related kinase 1; Ndr Ser/Thr kinase-like protein; serine threonine protein kinase; NDR1; |
Gene ID | 11329 |
mRNA Refseq | NM_007271 |
Protein Refseq | NP_009202 |
MIM | 606964 |
UniProt ID | Q15208 |
◆ Recombinant Proteins | ||
STK38-29508TH | Recombinant Human STK38 | +Inquiry |
STK38-1106H | Recombinant Human Serine/Threonine Kinase 38, GST-tagged | +Inquiry |
STK38-2126H | Recombinant Human STK38 Protein, His (Fc)-Avi-tagged | +Inquiry |
STK38-1180H | Active Recombinant Human STK38 Protein, Myc/DDK-tagged | +Inquiry |
STK38-4344R | Recombinant Rhesus Macaque STK38 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STK38-1400HCL | Recombinant Human STK38 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STK38 Products
Required fields are marked with *
My Review for All STK38 Products
Required fields are marked with *
0
Inquiry Basket