Recombinant Human SERPINA10 protein, His-tagged
| Cat.No. : | SERPINA10-2588H |
| Product Overview : | Recombinant Human SERPINA10 protein(1-444 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-444 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SERPINA10 serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 [ Homo sapiens ] |
| Official Symbol | SERPINA10 |
| Synonyms | SERPINA10; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 10; protein Z-dependent protease inhibitor; PZI; ZPI; serpin A10; PZ-dependent protease inhibitor; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; |
| Gene ID | 51156 |
| mRNA Refseq | NM_001100607 |
| Protein Refseq | NP_001094077 |
| MIM | 605271 |
| UniProt ID | Q9UK55 |
| ◆ Recombinant Proteins | ||
| SERPINA10-2102H | Recombinant Human SERPINA10 protein, His & GST-tagged | +Inquiry |
| Serpina10-2105R | Recombinant Rat Serpina10 protein, His & S-tagged | +Inquiry |
| SERPINA10-2588H | Recombinant Human SERPINA10 protein, His-tagged | +Inquiry |
| Serpina10-2104R | Recombinant Rat Serpina10 protein, His & S-tagged | +Inquiry |
| SERPINA10-3862H | Recombinant Human SERPINA10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERPINA10-2068MCL | Recombinant Mouse SERPINA10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINA10 Products
Required fields are marked with *
My Review for All SERPINA10 Products
Required fields are marked with *
