Recombinant Human SERPINA10 protein, His-tagged
Cat.No. : | SERPINA10-2588H |
Product Overview : | Recombinant Human SERPINA10 protein(1-444 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-444 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SERPINA10 serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 [ Homo sapiens ] |
Official Symbol | SERPINA10 |
Synonyms | SERPINA10; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 10; protein Z-dependent protease inhibitor; PZI; ZPI; serpin A10; PZ-dependent protease inhibitor; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; |
Gene ID | 51156 |
mRNA Refseq | NM_001100607 |
Protein Refseq | NP_001094077 |
MIM | 605271 |
UniProt ID | Q9UK55 |
◆ Recombinant Proteins | ||
Serpina10-5783M | Recombinant Mouse Serpina10 Protein, Myc/DDK-tagged | +Inquiry |
SERPINA10-4994R | Recombinant Rat SERPINA10 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINA10-186H | Recombinant Human SERPINA10, His-tagged | +Inquiry |
SERPINA10-5894H | Recombinant Human SERPINA10 Protein (Leu22-Leu444), C-His tagged | +Inquiry |
Serpina10-4023M | Recombinant Mouse Serpina10 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINA10-2068MCL | Recombinant Mouse SERPINA10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINA10 Products
Required fields are marked with *
My Review for All SERPINA10 Products
Required fields are marked with *
0
Inquiry Basket