Recombinant Human SERPINA10 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SERPINA10-3862H |
Product Overview : | SERPINA10 MS Standard C13 and N15-labeled recombinant protein (NP_057270) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the serpin family. It is predominantly expressed in the liver and secreted in plasma. It inhibits the activity of coagulation factors Xa and XIa in the presence of protein Z, calcium and phospholipid. Mutations in this gene are associated with venous thrombosis. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 50.5 kDa |
AA Sequence : | MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SERPINA10 serpin family A member 10 [ Homo sapiens (human) ] |
Official Symbol | SERPINA10 |
Synonyms | SERPINA10; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 10; protein Z-dependent protease inhibitor; PZI; ZPI; serpin A10; PZ-dependent protease inhibitor; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; |
Gene ID | 51156 |
mRNA Refseq | NM_016186 |
Protein Refseq | NP_057270 |
MIM | 605271 |
UniProt ID | Q9UK55 |
◆ Recombinant Proteins | ||
SERPINA10-186H | Recombinant Human SERPINA10, His-tagged | +Inquiry |
SERPINA10-2588H | Recombinant Human SERPINA10 protein, His-tagged | +Inquiry |
SERPINA10-865H | Recombinant Human SERPINA10 Protein, MYC/DDK-tagged | +Inquiry |
SERPINA10-5335R | Recombinant Rat SERPINA10 Protein | +Inquiry |
Serpina10-2104R | Recombinant Rat Serpina10 protein, His & S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINA10-2068MCL | Recombinant Mouse SERPINA10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINA10 Products
Required fields are marked with *
My Review for All SERPINA10 Products
Required fields are marked with *